Products

View as table Download

GTF2H1 (Myc-DDK-tagged)-Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

GTF2H1 (Myc-DDK-tagged)-Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, GTF2H1 (Myc-DDK tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, GTF2H1 (mGFP-tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

GTF2H1 (GFP-tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Recombinant protein of human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GTF2H1 (Myc-DDK tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GTF2H1 (mGFP-tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GTF2H1 (Myc-DDK tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, GTF2H1 (mGFP-tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

GTF2H1 (GFP-tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

GTF2H1 (untagged)-Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal anti-TF2H1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human TF2H1.

Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Mouse Monoclonal GTF2H1 Antibody

Applications IF, IP, WB
Reactivities Human
Conjugation Unconjugated

GTF2H1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse

GTF2H1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Rabbit Polyclonal Anti-GTF2H1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the N terminal of human GTF2H1. Synthetic peptide located within the following region: EEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKI

Rabbit Polyclonal Anti-GTF2H1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the middle region of human GTF2H1. Synthetic peptide located within the following region: ERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKK

GTF2H1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

GTF2H1 MS Standard C13 and N15-labeled recombinant protein (NP_005307)

Tag C-Myc/DDK
Expression Host HEK293

GTF2H1 (untagged)-Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

USD 1,130.00

4 Weeks

Transient overexpression of GTF2H1 (NM_005316) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 1,130.00

4 Weeks

Transient overexpression of GTF2H1 (NM_001142307) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of GTF2H1 (NM_005316) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of GTF2H1 (NM_005316) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of GTF2H1 (NM_001142307) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of GTF2H1 (NM_001142307) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack