Germany
Japan
United Kingdom
China
TAF2 (Myc-DDK-tagged)-Human TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa (TAF2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
TAF2 (GFP-tagged) - Human TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa (TAF2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa (TAF2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TAF2 (Myc-DDK tagged) - Human TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa (TAF2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa (TAF2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TAF2 (mGFP-tagged) - Human TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa (TAF2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-TAF2 Antibody
| Applications | 10k-ChIP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAF2 Antibody: synthetic peptide directed towards the middle region of human TAF2. Synthetic peptide located within the following region: RKRNVLELEIKQDYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKH |
TAF2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TAF2 (untagged)-Human TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa (TAF2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Carrier-free (BSA/glycerol-free) TAF2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression lysate of TAF2 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 150kDa (TAF2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
TAF2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TAF2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
TAF2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
TAF2 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression of TAF2 (NM_003184) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TAF2 (NM_003184) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TAF2 (NM_003184) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TAF2
Pathways
- Basal transcription factors