Germany
Japan
United Kingdom
China
TBPL2 (Myc-DDK-tagged)-Human TATA box binding protein like 2 (TBPL2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
TBPL2 (GFP-tagged) - Human TATA box binding protein like 2 (TBPL2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human TATA box binding protein like 2 (TBPL2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TBPL2 (Myc-DDK tagged) - Human TATA box binding protein like 2 (TBPL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human TATA box binding protein like 2 (TBPL2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TBPL2 (mGFP-tagged) - Human TATA box binding protein like 2 (TBPL2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Transient overexpression lysate of TATA box binding protein like 2 (TBPL2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit polyclonal TBPL2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBPL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-39 amino acids from the N-terminal region of human TBPL2. |
TBPL2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Purified recombinant protein of Human TATA box binding protein like 2 (TBPL2), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
Rabbit Polyclonal Anti-TBPL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TBPL2 antibody is: synthetic peptide directed towards the N-terminal region of Human TBPL2. Synthetic peptide located within the following region: SGDFSSVDLSFLPDEVTQENKDQPVISKHETEENSESQSPQSRLPSPSEQ |
TBPL2 (untagged)-Human TATA box binding protein like 2 (TBPL2)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of TBPL2 (NM_199047) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TBPL2 (NM_199047) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TBPL2 (NM_199047) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TBPL2
Pathways
- Basal transcription factors