Products

cDNA Clones (10)
Antibodies (4)
Proteins (3)
Jump to Filters
View as table Download
acyl CoA Thioesterase 2 (ACOT2) (NM_006821) Human Tagged ORF Clone
RC202837

USD 420.00

In Stock

ACOT2 (Myc-DDK-tagged)-Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
acyl CoA Thioesterase 2 (ACOT2) (NM_006821) Human Tagged ORF Clone Lentiviral Particle
RC202837L3V

USD 820.00

11 Weeks

Lenti ORF particles, ACOT2 (Myc-DDK-tagged)-Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
acyl CoA Thioesterase 2 (ACOT2) (NM_006821) Human Tagged ORF Clone Lentiviral Particle
RC202837L4V

USD 820.00

11 Weeks

Lenti ORF particles, ACOT2 (mGFP-tagged)-Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
acyl CoA Thioesterase 2 (ACOT2) (NM_006821) Human Tagged ORF Clone
RG202837

USD 460.00

3 Weeks

ACOT2 (GFP-tagged) - Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
acyl CoA Thioesterase 2 (ACOT2) Rabbit Polyclonal Antibody
TA346440

USD 475.00

5 Days

Rabbit Polyclonal Anti-ACOT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACOT2 antibody: synthetic peptide directed towards the middle region of human ACOT2. Synthetic peptide located within the following region: SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGR
acyl CoA Thioesterase 2 (ACOT2) (NM_006821) Human Untagged Clone
SC122761

USD 310.00

In Stock

ACOT2 (untagged)-Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
acyl CoA Thioesterase 2 (ACOT2) Rabbit Polyclonal Antibody
TA322466

USD 345.00

In Stock

Anti-ACOT2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 169-468 amino acids of human acyl-CoA thioesterase 2
acyl CoA Thioesterase 2 (ACOT2) (NM_006821) Human Tagged ORF Clone
RC202837L2

USD 620.00

3 Weeks

Lenti-ORF clone of ACOT2 (mGFP-tagged)-Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
acyl CoA Thioesterase 2 (ACOT2) Rabbit Polyclonal Antibody
TA315131

USD 345.00

2 Weeks

Rabbit polyclonal anti-ACOT2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ACOT2
acyl CoA Thioesterase 2 (ACOT2) Rabbit Polyclonal Antibody
TA322465

USD 345.00

In Stock

Anti-ACOT2 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 169-468 amino acids of human acyl-CoA thioesterase 2
acyl CoA Thioesterase 2 (ACOT2) (NM_006821) ICC Control Block
TB402837

USD 1,070.00

4 Weeks

Transient overexpression of ACOT2 (NM_006821) in HEK293T cells paraffin embedded controls for ICC/IHC staining

acyl CoA Thioesterase 2 (ACOT2) Cytosection
TS402837

USD 225.00

4 Weeks

Transient overexpression of ACOT2 (NM_006821) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

acyl CoA Thioesterase 2 (ACOT2) Cytosection
TS402837P5

USD 889.00

4 Weeks

Transient overexpression of ACOT2 (NM_006821) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack