Germany
Japan
United Kingdom
China
USD 820.00
3 Weeks
Lenti ORF particles, ACOT2 (Myc-DDK-tagged)-Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Products
View as table DownloadUSD 820.00
6 Weeks
Lenti ORF particles, ACOT2 (mGFP-tagged)-Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ACOT2 (Myc-DDK-tagged)-Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Acot2 (Myc-DDK-tagged) - Mouse acyl-CoA thioesterase 2 (Acot2), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACOT2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN402837 is the updated version of KN202837.
Acot2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500732 is the updated version of KN300732.
Acot2 (GFP-tagged) - Mouse acyl-CoA thioesterase 2 (Acot2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Acot2 (Myc-DDK-tagged) - Mouse acyl-CoA thioesterase 2 (Acot2), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acot2 (Myc-DDK-tagged) - Mouse acyl-CoA thioesterase 2 (Acot2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Acot2 (mGFP-tagged) - Mouse acyl-CoA thioesterase 2 (Acot2), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acot2 (GFP-tagged) - Mouse acyl-CoA thioesterase 2 (Acot2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ACOT2 (Myc-DDK-tagged)-Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, ACOT2 (Myc-DDK-tagged)-Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ACOT2 (mGFP-tagged)-Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
11 Weeks
Lenti ORF particles, ACOT2 (mGFP-tagged)-Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ACOT2 (GFP-tagged) - Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Acot2 (Myc-DDK-tagged ORF) - Rat acyl-CoA thioesterase 2 (Acot2), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Acot2 (Myc-DDK-tagged ORF) - Rat acyl-CoA thioesterase 2 (Acot2), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acot2 (Myc-DDK-tagged ORF) - Rat acyl-CoA thioesterase 2 (Acot2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Acot2 (mGFP-tagged ORF) - Rat acyl-CoA thioesterase 2 (Acot2), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Acot2 (GFP-tagged ORF) - Rat acyl-CoA thioesterase 2 (Acot2), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-ACOT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACOT2 antibody: synthetic peptide directed towards the middle region of human ACOT2. Synthetic peptide located within the following region: SPLEGPDQKSFIPVERAESTFLFLVGQDDHNWKSEFYANEACKRLQAHGR |
ACOT2 (untagged)-Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti-ORF clone of ACOT2 (mGFP-tagged)-Human acyl-CoA thioesterase 2 (ACOT2), nuclear gene encoding mitochondrial protein
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Acot2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Rabbit polyclonal anti-ACOT2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ACOT2 |
qSTAR qPCR primer pairs against Homo sapiens gene ACOT2
qSTAR qPCR primer pairs against Mus musculus gene Acot2
ACOT2 CRISPRa kit - CRISPR gene activation of human acyl-CoA thioesterase 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Acot2 CRISPRa kit - CRISPR gene activation of mouse acyl-CoA thioesterase 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ACOT2
| Application | Plasmid of exact quantity for transcript copy number calculation |
Acot2 (untagged) - Mouse acyl-CoA thioesterase 2 (Acot2), nuclear gene encoding mitochondrial protein, (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Acot2 (untagged ORF) - Rat acyl-CoA thioesterase 2 (Acot2), nuclear gene encoding mitochondrial protein, (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of acyl-CoA thioesterase 2 (ACOT2) nuclear gene encoding mitochondrial protein for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Acot2 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-ACOT2 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 169-468 amino acids of human acyl-CoA thioesterase 2 |
ACOT2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N region of human ACOT2 |
ACOT2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 222-483 of human ACOT2 (NP_006812.3). |
| Modifications | Unmodified |
Transient overexpression of ACOT2 (NM_006821) in HEK293T cells paraffin embedded controls for ICC/IHC staining
USD 815.00
2 Weeks
ACOT2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
USD 1,395.00
5 Weeks
ACOT2 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Acot2 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Acot2 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Acot2 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Acot2 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
USD 715.00
2 Weeks
ACOT2 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Acot2 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Acot2 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of ACOT2 (NM_006821) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- ACOT2