HSD17B12 (Myc-DDK-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
HSD17B12 (Myc-DDK-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of HSD17B12 (Myc-DDK-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HSD17B12 (Myc-DDK-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of HSD17B12 (mGFP-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, HSD17B12 (mGFP-tagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
HSD17B12 (GFP-tagged) - Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
HSD17B12 (untagged)-Human hydroxysteroid (17-beta) dehydrogenase 12 (HSD17B12)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
HSD17B12 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 133~163 amino acids from the Center region of human 17-beta-HSD12 / HSD17B12 |
Rabbit Polyclonal Anti-Hsd17b12 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Hsd17b12 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Hsd17b12. Synthetic peptide located within the following region: SAETFVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFSKS |
Rabbit Polyclonal Anti-HSD17B12 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HSD17B12 |
Transient overexpression of HSD17B12 (NM_016142) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HSD17B12 (NM_016142) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HSD17B12 (NM_016142) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack