Products

cDNA Clones (14)
Proteins (8)
Antibodies (1)
Jump to Filters
View as table Download
PDHB (NM_001173468) Human Tagged ORF Clone
RC229907

USD 420.00

In Stock

PDHB (Myc-DDK-tagged)-Human pyruvate dehydrogenase (lipoamide) beta (PDHB), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PDHB (NM_000925) Human Tagged ORF Clone
RC201230

USD 420.00

3 Weeks

PDHB (Myc-DDK-tagged)-Human pyruvate dehydrogenase (lipoamide) beta (PDHB), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
PDHB (NM_000925) Human Tagged ORF Clone
RC201230L3

USD 620.00

3 Weeks

Lenti-ORF clone of PDHB (Myc-DDK-tagged)-Human pyruvate dehydrogenase (lipoamide) beta (PDHB), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDHB (NM_000925) Human Tagged ORF Clone Lentiviral Particle
RC201230L3V

USD 820.00

6 Weeks

Lenti ORF particles, PDHB (Myc-DDK-tagged)-Human pyruvate dehydrogenase (lipoamide) beta (PDHB), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDHB (NM_000925) Human Tagged ORF Clone
RC201230L4

USD 620.00

3 Weeks

Lenti-ORF clone of PDHB (mGFP-tagged)-Human pyruvate dehydrogenase (lipoamide) beta (PDHB), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDHB (NM_000925) Human Tagged ORF Clone Lentiviral Particle
RC201230L4V

USD 820.00

6 Weeks

Lenti ORF particles, PDHB (mGFP-tagged)-Human pyruvate dehydrogenase (lipoamide) beta (PDHB), nuclear gene encoding mitochondrial protein, transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDHB (NM_001173468) Human Tagged ORF Clone
RC229907L3

USD 620.00

3 Weeks

Lenti ORF clone of Human pyruvate dehydrogenase (lipoamide) beta (PDHB), nuclear gene encoding mitochondrial protein, transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDHB (NM_001173468) Human Tagged ORF Clone Lentiviral Particle
RC229907L3V

USD 820.00

6 Weeks

Lenti ORF particles, PDHB (Myc-DDK tagged) - Human pyruvate dehydrogenase (lipoamide) beta (PDHB), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PDHB (NM_001173468) Human Tagged ORF Clone
RC229907L4

USD 620.00

3 Weeks

Lenti ORF clone of Human pyruvate dehydrogenase (lipoamide) beta (PDHB), nuclear gene encoding mitochondrial protein, transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDHB (NM_001173468) Human Tagged ORF Clone Lentiviral Particle
RC229907L4V

USD 820.00

6 Weeks

Lenti ORF particles, PDHB (mGFP-tagged) - Human pyruvate dehydrogenase (lipoamide) beta (PDHB), nuclear gene encoding mitochondrial protein, transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PDHB (NM_000925) Human Tagged ORF Clone
RG201230

USD 460.00

4 Weeks

PDHB (GFP-tagged) - Human pyruvate dehydrogenase (lipoamide) beta (PDHB), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDHB (NM_001173468) Human Tagged ORF Clone
RG229907

USD 460.00

3 Weeks

PDHB (GFP-tagged) - Human pyruvate dehydrogenase (lipoamide) beta (PDHB), nuclear gene encoding mitochondrial protein, transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PDHB (NM_001173468) Human Recombinant Protein
TP761460

USD 215.00

In Stock

Purified recombinant protein of Human pyruvate dehydrogenase (lipoamide) beta (PDHB), nuclear gene encoding mitochondrial protein, transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
PDHB (NM_000925) Human Untagged Clone
SC119582

USD 310.00

In Stock

PDHB (untagged)-Human pyruvate dehydrogenase (lipoamide) beta (PDHB), nuclear gene encoding mitochondrial protein, transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PDHB Rabbit Polyclonal Antibody
TA346540

USD 475.00

5 Days

Rabbit Polyclonal Anti-PDHB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDHB antibody: synthetic peptide directed towards the N terminal of human PDHB. Synthetic peptide located within the following region: GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAID
PDHB (NM_001173468) Human Over-expression Lysate
LC432907

USD 121.00

2 Weeks

PDHB HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PDHB (NM_001173468) Human Over-expression Lysate
LY432907

USD 396.00

5 Days

Transient overexpression lysate of pyruvate dehydrogenase (lipoamide) beta (PDHB), nuclear gene encoding mitochondrial protein, transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PDHB (NM_001173468) Human Untagged Clone
SC328545

USD 580.00

3 Weeks

PDHB (untagged)-Human pyruvate dehydrogenase (lipoamide) beta (PDHB) nuclear gene encoding mitochondrial protein transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PDHB ICC Control Block
TB401230

USD 1,070.00

4 Weeks

Transient overexpression of PDHB (NM_000925) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PDHB ICC Control Block
TB429907

USD 1,070.00

4 Weeks

Transient overexpression of PDHB (NM_001173468) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PDHB ICC Control Sections
TS401230P5

USD 889.00

4 Weeks

Transient overexpression of PDHB (NM_000925) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

PDHB Cytosection
TS429907

USD 225.00

4 Weeks

Transient overexpression of PDHB (NM_001173468) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PDHB Cytosection
TS429907P5

USD 889.00

4 Weeks

Transient overexpression of PDHB (NM_001173468) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack