Germany
Japan
United Kingdom
China
MYLK3 (Myc-DDK-tagged)-Human myosin light chain kinase 3 (MYLK3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti ORF particles, MYLK3 (Myc-DDK-tagged)-Human myosin light chain kinase 3 (MYLK3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, MYLK3 (mGFP-tagged)-Human myosin light chain kinase 3 (MYLK3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
MYLK3 (GFP-tagged) - Human myosin light chain kinase 3 (MYLK3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of MYLK3 (Myc-DDK-tagged)-Human myosin light chain kinase 3 (MYLK3)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MYLK3 (Myc-DDK-tagged)-Human myosin light chain kinase 3 (MYLK3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MYLK3 (mGFP-tagged)-Human myosin light chain kinase 3 (MYLK3)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MYLK3 (mGFP-tagged)-Human myosin light chain kinase 3 (MYLK3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of MYLK3 (Myc-DDK-tagged)-Human myosin light chain kinase 3 (MYLK3)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of myosin light chain kinase 3 (MYLK3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti-ORF clone of MYLK3 (mGFP-tagged)-Human myosin light chain kinase 3 (MYLK3)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
MYLK3 (untagged)-Kinase deficient mutant (K520M) of Human myosin light chain kinase 3 (MYLK3)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
MYLK3 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 542-570aa) of human MLCK / MYLK3 |
Rabbit Polyclonal Anti-MYLK3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MYLK3 Antibody is: synthetic peptide directed towards the C-terminal region of Human MYLK3. Synthetic peptide located within the following region: LVKEKSCRMSATQCLKHEWLNNLPAKASRSKTRLKSQLLLQKYIAQRKWK |
MYLK3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression of MYLK3 (NM_182493) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MYLK3 (NM_182493) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MYLK3 (NM_182493) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- MYLK3
Pathways
- Calcium signaling pathway