Products

cDNA Clones (8)
Proteins (5)
Antibodies (1)
Jump to Filters
View as table Download
Claudin 9 (CLDN9) (NM_020982) Human Tagged ORF Clone
RG208701

USD 460.00

In Stock

CLDN9 (GFP-tagged) - Human claudin 9 (CLDN9)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Claudin 9 (CLDN9) (NM_020982) Human Untagged Clone
SC322029

USD 420.00

In Stock

CLDN9 (untagged)-Human claudin 9 (CLDN9)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Claudin 9 (CLDN9) (NM_020982) Human Over-expression Lysate
LY412160

USD 396.00

2 Weeks

Transient overexpression lysate of claudin 9 (CLDN9)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 9 (CLDN9) (NM_020982) Human Over-expression Lysate
LC412160

USD 121.00

In Stock

CLDN9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Claudin 9 (CLDN9) Rabbit Polyclonal Antibody
TA334197

USD 310.00

2 Weeks

Rabbit Polyclonal Anti-CLDN9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN9 antibody: synthetic peptide directed towards the C terminal of human CLDN9. Synthetic peptide located within the following region: WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
Claudin 9 (CLDN9) (NM_020982) Human Mass Spec Standard
PH308701

USD 2,055.00

3 Weeks

CLDN9 MS Standard C13 and N15-labeled recombinant protein (NP_066192)

Tag C-Myc/DDK
Expression Host HEK293
Claudin 9 (CLDN9) Cytosection
TS408701

USD 225.00

4 Weeks

Transient overexpression of CLDN9 (NM_020982) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack