Germany
Japan
United Kingdom
China
HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
USD 820.00
3 Weeks
Lenti ORF particles, HLA (Myc-DDK tagged) - Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, HLA (mGFP-tagged) - Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
HLA (GFP-tagged) - Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, HLA (Myc-DDK tagged) - Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, HLA (mGFP-tagged) - Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
HLA HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Anti-HLA-DQA2 & HLA-DQA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QGLRSVGASRH, from the C Terminus of the protein sequence according to NP_064440.1; NP_002113.2. |
Rabbit polyclonal Anti-HLA-DQA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the N terminal of human HLA-DQA2. Synthetic peptide located within the following region: GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS |
Rabbit polyclonal Anti-HLA-DQA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the middle region of human HLA-DQA2. Synthetic peptide located within the following region: LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK |
Carrier-free (BSA/glycerol-free) HLA-DQA2 mouse monoclonal antibody,clone OTI3E6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HLA-DQA2 mouse monoclonal antibody,clone OTI4C9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
HLA (untagged)-Human major histocompatibility complex, class II, DQ alpha 2 (HLA-DQA2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
HLA-DQA2 mouse monoclonal antibody,clone OTI3E6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HLA-DQA2 mouse monoclonal antibody,clone OTI3E6, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
HLA-DQA2 mouse monoclonal antibody,clone OTI3E6, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
HLA-DQA2 mouse monoclonal antibody,clone OTI3E6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
HLA-DQA2 mouse monoclonal antibody,clone OTI4C9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
HLA-DQA2 mouse monoclonal antibody,clone OTI4C9, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
HLA-DQA2 mouse monoclonal antibody,clone OTI4C9, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
HLA-DQA2 mouse monoclonal antibody,clone OTI4C9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Transient overexpression of HLA-DQA2 (NM_020056) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HLA-DQA2 (NM_020056) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HLA-DQA2 (NM_020056) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- HLA-DQA2
Pathways
- Cell adhesion molecules (CAMs)