Products

View as table Download

CDC23 (Myc-DDK-tagged)-Human cell division cycle 23 homolog (S. cerevisiae) (CDC23)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, CDC23 (Myc-DDK tagged) - Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, CDC23 (mGFP-tagged) - Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

CDC23 (GFP-tagged) - Human cell division cycle 23 homolog (S. cerevisiae) (CDC23)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CDC23 (Myc-DDK tagged) - Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, CDC23 (mGFP-tagged) - Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Transient overexpression lysate of cell division cycle 23 homolog (S. cerevisiae) (CDC23)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

CDC23 (untagged)-Human cell division cycle 23 homolog (S. cerevisiae) (CDC23)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

CDC23 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit Polyclonal APC8 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC8 antibody was raised against a 17 amino acid synthetic peptide near the center of human APC8.

Rabbit polyclonal anti-APC8 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human APC8.

Rabbit Polyclonal Anti-IRF6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IRF6 Antibody: synthetic peptide directed towards the C terminal of human IRF6. Synthetic peptide located within the following region: FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR

CDC23 (untagged)-Homo sapiens, clone MGC:13585 IMAGE:4281800, complete cds

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

CDC23 (untagged)-Human cell division cycle 23 homolog (S. cerevisiae) (CDC23)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Rabbit Polyclonal Anti-CDC23 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDC23

CDC23 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CDC23

CDC23 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CDC23

Transient overexpression of CDC23 (NM_004661) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of CDC23 (NM_004661) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of CDC23 (NM_004661) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack