CDC23 (Myc-DDK-tagged)-Human cell division cycle 23 homolog (S. cerevisiae) (CDC23)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC23 (Myc-DDK-tagged)-Human cell division cycle 23 homolog (S. cerevisiae) (CDC23)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CDC23 (Myc-DDK tagged) - Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CDC23 (mGFP-tagged) - Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CDC23 (GFP-tagged) - Human cell division cycle 23 homolog (S. cerevisiae) (CDC23)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC23 (Myc-DDK tagged) - Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC23 (mGFP-tagged) - Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of cell division cycle 23 homolog (S. cerevisiae) (CDC23)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CDC23 (untagged)-Human cell division cycle 23 homolog (S. cerevisiae) (CDC23)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CDC23 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal APC8 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APC8 antibody was raised against a 17 amino acid synthetic peptide near the center of human APC8. |
Rabbit polyclonal anti-APC8 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APC8. |
Rabbit Polyclonal Anti-IRF6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IRF6 Antibody: synthetic peptide directed towards the C terminal of human IRF6. Synthetic peptide located within the following region: FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR |
CDC23 (untagged)-Homo sapiens, clone MGC:13585 IMAGE:4281800, complete cds
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CDC23 (untagged)-Human cell division cycle 23 homolog (S. cerevisiae) (CDC23)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-CDC23 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CDC23 |
CDC23 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CDC23 |
CDC23 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CDC23 |
Transient overexpression of CDC23 (NM_004661) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC23 (NM_004661) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDC23 (NM_004661) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack