Germany
Japan
United Kingdom
China
CDC23 (Myc-DDK-tagged)-Human cell division cycle 23 homolog (S. cerevisiae) (CDC23)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, CDC23 (Myc-DDK tagged) - Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CDC23 (mGFP-tagged) - Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CDC23 (GFP-tagged) - Human cell division cycle 23 homolog (S. cerevisiae) (CDC23)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDC23 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN424973 is the updated version of KN224973.
Cdc23 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN502963 is the updated version of KN302963.
Cdc23 (GFP-tagged) - Mouse CDC23 (cell division cycle 23, yeast, homolog) (cDNA clone MGC:69646 IMAGE:6813730)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Cdc23 (GFP-tagged) - Mouse CDC23 (cell division cycle 23 yeast homolog) (Cdc23), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Cdc23 (Myc-DDK-tagged) - Mouse CDC23 (cell division cycle 23, yeast, homolog) (cDNA clone MGC:69646 IMAGE:6813730)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cdc23 (Myc-DDK-tagged) - Mouse CDC23 (cell division cycle 23, yeast, homolog) (cDNA clone MGC:69646 IMAGE:6813730)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc23 (Myc-DDK-tagged) - Mouse CDC23 (cell division cycle 23, yeast, homolog) (cDNA clone MGC:69646 IMAGE:6813730), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cdc23 (mGFP-tagged) - Mouse CDC23 (cell division cycle 23, yeast, homolog) (cDNA clone MGC:69646 IMAGE:6813730)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc23 (GFP-tagged) - Mouse CDC23 (cell division cycle 23, yeast, homolog) (cDNA clone MGC:69646 IMAGE:6813730), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Cdc23 (Myc-DDK-tagged) - Mouse CDC23 (cell division cycle 23, yeast, homolog) (Cdc23)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cdc23 (Myc-DDK-tagged) - Mouse CDC23 (cell division cycle 23, yeast, homolog) (Cdc23)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc23 (Myc-DDK-tagged) - Mouse CDC23 (cell division cycle 23, yeast, homolog) (Cdc23), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cdc23 (mGFP-tagged) - Mouse CDC23 (cell division cycle 23, yeast, homolog) (Cdc23)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc23 (GFP-tagged) - Mouse CDC23 (cell division cycle 23, yeast, homolog) (Cdc23), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CDC23 (Myc-DDK tagged) - Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CDC23 (mGFP-tagged) - Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Cdc23 (Myc-DDK-tagged ORF) - Rat CDC23 (cell division cycle 23, yeast, homolog) (Cdc23), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cdc23 (Myc-DDK-tagged ORF) - Rat CDC23 (cell division cycle 23, yeast, homolog) (Cdc23), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc23 (Myc-DDK-tagged ORF) - Rat CDC23 (cell division cycle 23, yeast, homolog) (Cdc23), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cdc23 (mGFP-tagged ORF) - Rat CDC23 (cell division cycle 23, yeast, homolog) (Cdc23), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdc23 (GFP-tagged ORF) - Rat CDC23 (cell division cycle 23, yeast, homolog) (Cdc23), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of cell division cycle 23 homolog (S. cerevisiae) (CDC23)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CDC23 (untagged)-Human cell division cycle 23 homolog (S. cerevisiae) (CDC23)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Cdc23 (untagged) - Mouse CDC23 (cell division cycle 23, yeast, homolog) (cDNA clone MGC:69646 IMAGE:6813730), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cell division cycle 23 homolog (S. cerevisiae) (CDC23), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CDC23 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit polyclonal anti-APC8 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APC8. |
Rabbit Polyclonal Anti-IRF6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IRF6 Antibody: synthetic peptide directed towards the C terminal of human IRF6. Synthetic peptide located within the following region: FLSDLIAHQKGQIEKQPPFEIYLCFGEEWPDGKPLERKLILVQVIPVVAR |
CDC23 CRISPRa kit - CRISPR gene activation of human cell division cycle 23
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CDC23
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene CDC23
Cdc23 (untagged) - Mouse CDC23 (cell division cycle 23, yeast, homolog) (Cdc23), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Cdc23
Cdc23 (untagged ORF) - Rat CDC23 (cell division cycle 23, yeast, homolog) (Cdc23), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CDC23 (untagged)-Homo sapiens, clone MGC:13585 IMAGE:4281800, complete cds
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
3`UTR clone of cell division cycle 23 homolog (S. cerevisiae) (CDC23) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
CDC23 (untagged)-Human cell division cycle 23 homolog (S. cerevisiae) (CDC23)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CDC23 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Cdc23 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Cdc23 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-CDC23 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CDC23 |
CDC23 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CDC23 |
Active filters
Target Symbol
- CDC23