Products

cDNA Clones (39)
Proteins (29)
Antibodies (5)
Jump to Filters
View as table Download
Artemis (DCLRE1C) (NM_022487) Human Tagged ORF Clone
RC203407

USD 420.00

In Stock

DCLRE1C (Myc-DDK-tagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant b

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Artemis (DCLRE1C) (NM_001033855) Human Tagged ORF Clone
RC214185

USD 770.00

In Stock

DCLRE1C (Myc-DDK-tagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant a

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Artemis (DCLRE1C) (NM_001033857) Human Tagged ORF Clone
RC218094

USD 480.00

In Stock

DCLRE1C (Myc-DDK-tagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant d

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Artemis (DCLRE1C) (NM_001289077) Human Tagged ORF Clone
RC238936

USD 480.00

In Stock

DCLRE1C (myc-DDK-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant f

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Artemis (DCLRE1C) (NM_001289079) Human Tagged ORF Clone
RC238937

USD 480.00

In Stock

DCLRE1C (myc-DDK-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant h

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Artemis (DCLRE1C) (NM_001289076) Human Tagged ORF Clone
RC238959

USD 420.00

In Stock

DCLRE1C (myc-DDK-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant e

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Artemis (DCLRE1C) (NM_001289078) Human Tagged ORF Clone
RC238960

USD 420.00

In Stock

DCLRE1C (myc-DDK-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant g

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Artemis (DCLRE1C) (NM_022487) Human Tagged ORF Clone
RG203407

USD 460.00

In Stock

DCLRE1C (GFP-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant b

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Artemis (DCLRE1C) (NM_022487) Human Tagged ORF Clone
RC203407L3

USD 620.00

3 Weeks

Lenti ORF clone of Human DNA cross-link repair 1C (DCLRE1C), transcript variant b, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Artemis (DCLRE1C) (NM_022487) Human Tagged ORF Clone Lentiviral Particle
RC203407L3V

USD 820.00

5 Weeks

Lenti ORF particles, DCLRE1C (Myc-DDK tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Artemis (DCLRE1C) (NM_022487) Human Tagged ORF Clone
RC203407L4

USD 620.00

3 Weeks

Lenti ORF clone of Human DNA cross-link repair 1C (DCLRE1C), transcript variant b, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Artemis (DCLRE1C) (NM_022487) Human Tagged ORF Clone Lentiviral Particle
RC203407L4V

USD 820.00

7 Weeks

Lenti ORF particles, DCLRE1C (mGFP-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant b, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Artemis (DCLRE1C) (NM_001033858) Human Tagged ORF Clone Lentiviral Particle
RC212326L3V

USD 880.00

6 Weeks

Lenti ORF particles, DCLRE1C (Myc-DDK-tagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant c, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Artemis (DCLRE1C) (NM_001033858) Human Tagged ORF Clone Lentiviral Particle
RC212326L4V

USD 880.00

6 Weeks

Lenti ORF particles, DCLRE1C (mGFP-tagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant c, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Artemis (DCLRE1C) (NM_001033855) Human Tagged ORF Clone Lentiviral Particle
RC214185L3V

USD 1,170.00

6 Weeks

Lenti ORF particles, DCLRE1C (Myc-DDK-tagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Artemis (DCLRE1C) (NM_001033855) Human Tagged ORF Clone Lentiviral Particle
RC214185L4V

USD 1,170.00

6 Weeks

Lenti ORF particles, DCLRE1C (mGFP-tagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant a, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Artemis (DCLRE1C) (NM_001033857) Human Tagged ORF Clone
RC218094L3

USD 680.00

3 Weeks

Lenti-ORF clone of DCLRE1C (Myc-DDK-tagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant d

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Artemis (DCLRE1C) (NM_001033857) Human Tagged ORF Clone Lentiviral Particle
RC218094L3V

USD 880.00

6 Weeks

Lenti ORF particles, DCLRE1C (Myc-DDK-tagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant d, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Artemis (DCLRE1C) (NM_001033857) Human Tagged ORF Clone
RC218094L4

USD 680.00

3 Weeks

Lenti-ORF clone of DCLRE1C (mGFP-tagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant d

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Artemis (DCLRE1C) (NM_001033857) Human Tagged ORF Clone Lentiviral Particle
RC218094L4V

USD 880.00

6 Weeks

Lenti ORF particles, DCLRE1C (mGFP-tagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant d, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Artemis (DCLRE1C) (NM_001033858) Human Tagged ORF Clone
RG212326

USD 530.00

3 Weeks

DCLRE1C (GFP-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant c

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Artemis (DCLRE1C) (NM_001033855) Human Tagged ORF Clone
RG214185

USD 850.00

3 Weeks

DCLRE1C (GFP-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant a

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Artemis (DCLRE1C) (NM_001033857) Human Tagged ORF Clone
RG218094

USD 530.00

3 Weeks

DCLRE1C (GFP-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant d

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Artemis (DCLRE1C) (NM_022487) Human Untagged Clone
SC127058

USD 310.00

In Stock

DCLRE1C (untagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant b

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Artemis (DCLRE1C) (NM_001033855) Human Over-expression Lysate
LY422421

USD 605.00

In Stock

Transient overexpression lysate of DNA cross-link repair 1C (PSO2 homolog, S. cerevisiae) (DCLRE1C), transcript variant a

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Artemis (DCLRE1C) (NM_022487) Human Tagged ORF Clone
RC203407L2

USD 620.00

3 Weeks

Lenti ORF clone of Human DNA cross-link repair 1C (DCLRE1C), transcript variant b, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Artemis (DCLRE1C) (NM_001033855) Human Untagged Clone
SC302772

USD 1,410.00

In Stock

DCLRE1C (untagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant a

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Artemis (DCLRE1C) Goat Polyclonal Antibody
TA319208

USD 530.00

2 Weeks

Goat polyclonal anti-Artemis antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 482-495 of Human ARTEMIS (DCLRE1C DNA cross-link repair 1C).
Artemis (DCLRE1C) (N-term) Rabbit Polyclonal Antibody
AP51199PU-N

USD 512.00

2 Weeks

Artemis (DCLRE1C) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 28~58 amino acids from the N-terminal region of Human DCLRE1C.
Artemis (DCLRE1C) (NM_022487) Human Over-expression Lysate
LC402945

USD 121.00

In Stock

DCLRE1C HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Artemis (DCLRE1C) (NM_001033855) Human Over-expression Lysate
LC422421

USD 187.00

In Stock

DCLRE1C HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Artemis (DCLRE1C) (NM_022487) Human Over-expression Lysate
LY402945

USD 396.00

5 Days

Transient overexpression lysate of DNA cross-link repair 1C (PSO2 homolog, S. cerevisiae) (DCLRE1C), transcript variant b

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

Artemis (DCLRE1C) Rabbit Polyclonal Antibody
TA339872

USD 375.00

5 Days

Rabbit Polyclonal Anti-DCLRE1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCLRE1C antibody: synthetic peptide directed towards the N terminal of human DCLRE1C. Synthetic peptide located within the following region: SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRL
Artemis (DCLRE1C) Rabbit Polyclonal Antibody
TA309620

USD 350.00

5 Days

Rabbit Polyclonal Artemis Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to residues 677-692 [GESIAVKKRKCSLLDT] of the human Artemis protein.
Artemis (DCLRE1C) Rabbit Polyclonal Antibody
TA339873

USD 375.00

5 Days

Rabbit Polyclonal Anti-DCLRE1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCLRE1C antibody: synthetic peptide directed towards the C terminal of human DCLRE1C. Synthetic peptide located within the following region: SQSPKLFSDSDGESTHISSQNSSQSTHITEQGSQGWDSQSDTVLLSSQER
Artemis (DCLRE1C) (NM_001289077) Human Tagged ORF Clone
RG238936

USD 520.00

2 Weeks

DCLRE1C (GFP-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant f

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Artemis (DCLRE1C) (NM_001289079) Human Tagged ORF Clone
RG238937

USD 520.00

2 Weeks

DCLRE1C (GFP-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant h

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Artemis (DCLRE1C) (NM_001289076) Human Tagged ORF Clone
RG238959

USD 460.00

2 Weeks

DCLRE1C (GFP-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant e

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Artemis (DCLRE1C) (NM_001289078) Human Tagged ORF Clone
RG238960

USD 460.00

2 Weeks

DCLRE1C (GFP-tagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant g

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Artemis (DCLRE1C) (NM_001033857) Human Untagged Clone
SC302773

USD 970.00

4 Weeks

DCLRE1C (untagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant d

Vector pCMV6 series
Tag Tag Free
Artemis (DCLRE1C) (NM_001033858) Human Untagged Clone
SC302774

USD 970.00

4 Weeks

DCLRE1C (untagged)-Human DNA cross-link repair 1C (DCLRE1C), transcript variant c

Vector pCMV6 series
Tag Tag Free
Artemis (DCLRE1C) (NM_001289077) Human Untagged Clone
SC336830

USD 590.00

3 Weeks

DCLRE1C (untagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant f

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Artemis (DCLRE1C) (NM_001289079) Human Untagged Clone
SC336831

USD 590.00

3 Weeks

DCLRE1C (untagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant h

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Artemis (DCLRE1C) (NM_001289076) Human Untagged Clone
SC336853

USD 590.00

3 Weeks

DCLRE1C (untagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant e

Vector pCMV6 series
Tag Tag Free
Artemis (DCLRE1C) (NM_001289078) Human Untagged Clone
SC336854

USD 590.00

3 Weeks

DCLRE1C (untagged) - Human DNA cross-link repair 1C (DCLRE1C), transcript variant g

Vector pCMV6 series
Tag Tag Free
Artemis (DCLRE1C) (NM_022487) ICC Control Block
TB403407

USD 1,070.00

4 Weeks

Transient overexpression of DCLRE1C (NM_022487) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Artemis (DCLRE1C) (NM_001033858) ICC Control Block
TB412326

USD 1,130.00

4 Weeks

Transient overexpression of DCLRE1C (NM_001033858) in HEK293T cells paraffin embedded controls for ICC/IHC staining