Products

Proteins (13)
cDNA Clones (11)
Antibodies (2)
Jump to Filters
View as table Download
GADD45B (NM_015675) Human Tagged ORF Clone
RC213354

USD 98.00

USD 390.00

In Stock

GADD45B (Myc-DDK-tagged)-Human growth arrest and DNA-damage-inducible, beta (GADD45B)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GADD45B (NM_015675) Human Tagged ORF Clone Lentiviral Particle
RC213354L1V

USD 820.00

3 Weeks

Lenti ORF particles, GADD45B (Myc-DDK tagged) - Human growth arrest and DNA-damage-inducible, beta (GADD45B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GADD45B (NM_015675) Human Tagged ORF Clone Lentiviral Particle
RC213354L2V

USD 820.00

6 Weeks

Lenti ORF particles, GADD45B (mGFP-tagged) - Human growth arrest and DNA-damage-inducible, beta (GADD45B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GADD45B (NM_015675) Human Tagged ORF Clone
RG213354

USD 460.00

In Stock

GADD45B (GFP-tagged) - Human growth arrest and DNA-damage-inducible, beta (GADD45B)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GADD45B Rabbit Polyclonal Antibody
TA346618

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-GADD45B Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW
GADD45B (NM_015675) Human Tagged ORF Clone Lentiviral Particle
RC213354L3V

USD 820.00

5 Weeks

Lenti ORF particles, GADD45B (Myc-DDK tagged) - Human growth arrest and DNA-damage-inducible, beta (GADD45B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GADD45B (NM_015675) Human Tagged ORF Clone
RC213354L4

USD 620.00

In Stock

Lenti ORF clone of Human growth arrest and DNA-damage-inducible, beta (GADD45B), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GADD45B (NM_015675) Human Tagged ORF Clone Lentiviral Particle
RC213354L4V

USD 820.00

3 Weeks

Lenti ORF particles, GADD45B (mGFP-tagged) - Human growth arrest and DNA-damage-inducible, beta (GADD45B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GADD45B (NM_015675) Human Tagged Lenti ORF Clone
RC213354L1

USD 768.00

In Stock

Lenti ORF clone of Human growth arrest and DNA-damage-inducible, beta (GADD45B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GADD45B (NM_015675) Human Over-expression Lysate
LY414404

USD 396.00

In Stock

Transient overexpression lysate of growth arrest and DNA-damage-inducible, beta (GADD45B)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GADD45B (NM_015675) Human Untagged Clone
SC114608

USD 420.00

In Stock

GADD45B (untagged)-Human growth arrest and DNA-damage-inducible, beta (GADD45B)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GADD45B (NM_015675) Human Tagged ORF Clone
RC213354L2

USD 620.00

3 Weeks

Lenti ORF clone of Human growth arrest and DNA-damage-inducible, beta (GADD45B), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GADD45B (NM_015675) Human Over-expression Lysate
LC414404

USD 121.00

In Stock

GADD45B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GADD45B (NM_015675) Human Recombinant Protein
TP761954

USD 215.00

In Stock

Purified recombinant protein of Human growth arrest and DNA-damage-inducible, beta (GADD45B),full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
GADD45B (1-160) Human Protein
AR09108PU-L

USD 620.00

2 Weeks

GADD45B (1-160) human recombinant protein, 0.5 mg

Expression Host E. coli
GADD45B (1-160) Human Protein
AR09108PU-N

USD 260.00

2 Weeks

GADD45B (1-160) human recombinant protein, 0.1 mg

Expression Host E. coli
GADD45B (NM_015675) Human Mass Spec Standard
PH313354

USD 2,055.00

3 Weeks

GADD45B MS Standard C13 and N15-labeled recombinant protein (NP_056490)

Tag C-Myc/DDK
Expression Host HEK293
GADD45B Rabbit Polyclonal Antibody
TA350002

USD 345.00

In Stock

Rabbit Polyclonal Anti-GADD45B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GADD45B
GADD45B ICC Control Block
TB413354

USD 1,040.00

4 Weeks

Transient overexpression of GADD45B (NM_015675) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GADD45B (NM_015675) Human Recombinant Protein
TP720537

USD 330.00

3 Weeks

Recombinant protein of human growth arrest and DNA-damage-inducible, beta (GADD45B)

Tag N-His
Expression Host E. coli
GADD45B (NM_015675) Human Recombinant Protein
TP720537L

USD 1,900.00

3 Weeks

Recombinant protein of human growth arrest and DNA-damage-inducible, beta (GADD45B)

Tag N-His
Expression Host E. coli
GADD45B (NM_015675) Human Recombinant Protein
TP720537M

USD 760.00

3 Weeks

Recombinant protein of human growth arrest and DNA-damage-inducible, beta (GADD45B)

Tag N-His
Expression Host E. coli
GADD45B (NM_015675) Human Recombinant Protein
TP720537XL

USD 2,800.00

3 Weeks

Recombinant protein of human growth arrest and DNA-damage-inducible, beta (GADD45B)

Tag N-His
Expression Host E. coli
GADD45B Cytosection
TS413354

USD 225.00

4 Weeks

Transient overexpression of GADD45B (NM_015675) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GADD45B Cytosection
TS413354P5

USD 889.00

4 Weeks

Transient overexpression of GADD45B (NM_015675) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack