Products

cDNA Clones (11)
Antibodies (9)
Proteins (9)
Jump to Filters
View as table Download
14-3-3 theta (YWHAQ) (NM_006826) Human Tagged ORF Clone
RC208646

USD 98.00

USD 390.00

In Stock

YWHAQ (Myc-DDK-tagged)-Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
14-3-3 theta (YWHAQ) (NM_006826) Human Recombinant Protein
TP308646

USD 823.00

In Stock

Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ)

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

14-3-3 theta (YWHAQ) (NM_006826) Human Tagged ORF Clone Lentiviral Particle
RC208646L1V

USD 820.00

3 Weeks

Lenti ORF particles, YWHAQ (Myc-DDK tagged) - Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
14-3-3 theta (YWHAQ) (NM_006826) Human Tagged ORF Clone Lentiviral Particle
RC208646L2V

USD 820.00

6 Weeks

Lenti ORF particles, YWHAQ (mGFP-tagged) - Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
14-3-3 theta (YWHAQ) (NM_006826) Human Tagged ORF Clone
RG208646

USD 460.00

In Stock

YWHAQ (GFP-tagged) - Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
14-3-3 theta (YWHAQ) (NM_006826) Human Tagged ORF Clone Lentiviral Particle
RC208646L3V

USD 820.00

5 Weeks

Lenti ORF particles, YWHAQ (Myc-DDK tagged) - Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
14-3-3 theta (YWHAQ) (NM_006826) Human Tagged ORF Clone
RC208646L4

USD 620.00

In Stock

Lenti ORF clone of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
14-3-3 theta (YWHAQ) (NM_006826) Human Tagged ORF Clone Lentiviral Particle
RC208646L4V

USD 820.00

3 Weeks

Lenti ORF particles, YWHAQ (mGFP-tagged) - Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
14-3-3 theta (YWHAQ) (NM_006826) Human Untagged Clone
SC115879

USD 310.00

In Stock

YWHAQ (untagged)-Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
14-3-3 theta (YWHAQ) (NM_006826) Human Tagged ORF Clone
RC208646L1

USD 768.00

In Stock

Lenti ORF clone of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA327381

USD 275.00

In Stock

YWHAQ Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human YWHAQ
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
AP20329PU-N

USD 407.00

2 Weeks

14-3-3 theta (YWHAQ) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 200-240 of Human 14-3-3 θ.
14-3-3 theta (YWHAQ) (NM_006826) Human Tagged ORF Clone
RC208646L2

USD 620.00

3 Weeks

Lenti ORF clone of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
14-3-3 theta (YWHAQ) (NM_006826) Human Untagged Clone
SC322035

USD 310.00

In Stock

YWHAQ (untagged)-Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
14-3-3 theta (YWHAQ) Goat Polyclonal Antibody
TA303297

USD 375.00

In Stock

Goat Polyclonal Antibody against YWHAQ

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DDRKQTIDNSQ, from the internal region of the protein sequence according to NP_006817.1.
14-3-3 theta (YWHAQ) (NM_006826) Human Over-expression Lysate
LC416397

USD 121.00

In Stock

YWHAQ HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
14-3-3 theta (YWHAQ) (NM_006826) Human Over-expression Lysate
LY416397

USD 396.00

In Stock

Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide (YWHAQ)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA330345

USD 375.00

5 Days

Rabbit Polyclonal Anti-YWHAQ Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-YWHAQ antibody: synthetic peptide directed towards the N terminal of human YWHAQ. Synthetic peptide located within the following region: SVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSIC
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA312789

USD 345.00

4 Weeks

Rabbit polyclonal anti-14-3-3 theta antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 14-3-3 ?.
14-3-3 protein theta (1-245) Human Protein
AR09103PU-L

USD 1,105.00

2 Weeks

14-3-3 protein theta (1-245) human recombinant protein, 0.5 mg

Expression Host E. coli
14-3-3 protein theta (1-245) Human Protein
AR09103PU-N

USD 415.00

2 Weeks

14-3-3 protein theta (1-245) human recombinant protein, 0.1 mg

Expression Host E. coli
14-3-3 theta (YWHAQ) (NM_006826) Human Mass Spec Standard
PH308646

USD 2,055.00

3 Weeks

YWHAQ MS Standard C13 and N15-labeled recombinant protein (NP_006817)

Tag C-Myc/DDK
Expression Host HEK293
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA322463

USD 345.00

In Stock

Anti-YWHAQ Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
14-3-3 theta (YWHAQ) Rabbit Polyclonal Antibody
TA322464

USD 345.00

In Stock

Anti-YWHAQ Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide
14-3-3 theta (YWHAQ) (NM_006826) ICC Control Block
TB408646

USD 1,040.00

4 Weeks

Transient overexpression of YWHAQ (NM_006826) in HEK293T cells paraffin embedded controls for ICC/IHC staining

14-3-3 theta (YWHAQ) Cytosection
TS408646

USD 225.00

4 Weeks

Transient overexpression of YWHAQ (NM_006826) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

14-3-3 theta (YWHAQ) Cytosection
TS408646P5

USD 889.00

4 Weeks

Transient overexpression of YWHAQ (NM_006826) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack