14-3-3 theta (YWHAQ) (NM_006826) Human Mass Spec Standard

CAT#: PH308646

YWHAQ MS Standard C13 and N15-labeled recombinant protein (NP_006817)

Product Images

Coomassie blue staining of purified YWHAQ protein (Cat# TP308646). The protein was produced from HEK293T cells transfected with YWHAQ cDNA clone (Cat# RC208646) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208646
• Predicted MW: 27.8 kDa
• Protein Sequence:
  Sequence Link

  >RC208646 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTD
  TSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQ
  TIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDS
  YKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006817
• RefSeq Size: 2272
• RefSeq ORF: 735
• Synonyms: 1C5; 14-3-3; HS1
• Locus ID: 10971
• UniProt ID: P27348
• Cytogenetics: 2p25.1
• Summary: This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis, Pathogenic Escherichia coli infection