Germany
Japan
United Kingdom
China
CCL8 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 8 (CCL8)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CCL8 (GFP-tagged) - Human chemokine (C-C motif) ligand 8 (CCL8)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human chemokine (C-C motif) ligand 8 (CCL8), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CCL8 (Myc-DDK tagged) - Human chemokine (C-C motif) ligand 8 (CCL8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human chemokine (C-C motif) ligand 8 (CCL8), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CCL8 (mGFP-tagged) - Human chemokine (C-C motif) ligand 8 (CCL8), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
MCP-2 / CCL8 Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
Purified recombinant protein of Human chemokine (C-C motif) ligand 8 (CCL8).
| Tag | Tag Free |
| Expression Host | E. coli |
CCL8 (untagged)-Human chemokine (C-C motif) ligand 8 (CCL8)
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Purified recombinant protein of Human chemokine (C-C motif) ligand 8 (CCL8 / MCP-2)
| Tag | Tag Free |
| Expression Host | E. coli |
CCL8 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of chemokine (C-C motif) ligand 8 (CCL8)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Purified recombinant protein of Human chemokine (C-C motif) ligand 8 (CCL8), esidues 24-99aa, with C-terminal DDK tag,expressed in human cells;
| Tag | C-DDK |
| Expression Host | HEK293 |
Rabbit Polyclonal Anti-CCL8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCL8 antibody: synthetic peptide directed towards the middle region of human CCL8. Synthetic peptide located within the following region: SYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP |
Purified recombinant protein of Human chemokine (C-C motif) ligand 8 (CCL8)
| Tag | C-His |
| Expression Host | HEK293 |
Transient overexpression of CCL8 (NM_005623) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human chemokine (C-C motif) ligand 8 (CCL8)
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-C motif) ligand 8 (CCL8)
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-C motif) ligand 8 (CCL8)
| Tag | tag free |
| Expression Host | E. coli |
Recombinant protein of human chemokine (C-C motif) ligand 8 (CCL8)
| Tag | tag free |
| Expression Host | E. coli |
Purified recombinant protein of Human chemokine (C-C motif) ligand 8 (CCL8)
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human chemokine (C-C motif) ligand 8 (CCL8)
| Tag | C-His |
| Expression Host | HEK293 |
Purified recombinant protein of Human chemokine (C-C motif) ligand 8 (CCL8)
| Tag | C-His |
| Expression Host | HEK293 |
Transient overexpression of CCL8 (NM_005623) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CCL8 (NM_005623) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CCL8
Pathways
- Chemokine signaling pathway