CDC42 (Myc-DDK-tagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC42 (Myc-DDK-tagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC42 (Myc-DDK-tagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC42 (Myc-DDK-tagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CDC42 (GFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CDC42 (Myc-DDK tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CDC42 (mGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, CDC42 (Myc-DDK tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CDC42 (mGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CDC42 (GFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CDC42 (GFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CDC42 (Myc-DDK tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC42 (mGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC42 (Myc-DDK tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC42 (mGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC42 (Myc-DDK tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CDC42 (mGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CDC42 (untagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression lysate of cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit anti-CDC42 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CDC42 |
Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CDC42 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
CDC42 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CDC42 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CDC42 (untagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Chicken Polyclonal CDC42 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CDC42 antibody was raised against a 17 amino acid peptide near the amino terminus of human CDC42. |
Rabbit polyclonal anti-cdc42/Rac antibody
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides surrounding amino acid 144 of human cdc42 |
Rabbit Polyclonal Anti-CDC42 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC42 antibody: synthetic peptide directed towards the N terminal of human CDC42. Synthetic peptide located within the following region: DNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSP |
CDC42 (1-188, T7-tag) human recombinant protein, 0.5 mg
Tag | T7-tag |
Expression Host | E. coli |
CDC42 (1-188, T7-tag) human recombinant protein, 0.1 mg
Tag | T7-tag |
Expression Host | E. coli |
CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_001782)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_426359)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_001034891)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CDC42 (untagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Anti-Cdc42/Rho/Rac Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 57-71 amino acids of Human Cell division cycle 42 |
Transient overexpression of CDC42 (NM_001791) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC42 (NM_044472) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC42 (NM_001039802) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CDC42 (NM_001791) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CDC42 (NM_001791) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack