Products

Proteins (13)
cDNA Clones (7)
Antibodies (2)
Jump to Filters
View as table Download
MIG (CXCL9) (NM_002416) Human Tagged ORF Clone
RC210561

USD 98.00

USD 390.00

In Stock

CXCL9 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 9 (CXCL9)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
MIG (CXCL9) (NM_002416) Human Untagged Clone
SC118643

USD 310.00

In Stock

CXCL9 (untagged)-Human chemokine (C-X-C motif) ligand 9 (CXCL9)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
MIG (CXCL9) (NM_002416) Human Tagged ORF Clone
RG210561

USD 460.00

In Stock

CXCL9 (GFP-tagged) - Human chemokine (C-X-C motif) ligand 9 (CXCL9)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MIG (CXCL9) (NM_002416) Human Tagged ORF Clone
RC210561L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chemokine (C-X-C motif) ligand 9 (CXCL9), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MIG (CXCL9) (NM_002416) Human Tagged ORF Clone
RC210561L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chemokine (C-X-C motif) ligand 9 (CXCL9), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MIG (CXCL9) (NM_002416) Human Recombinant Protein
TP723301

USD 240.00

5 Days

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 9 (CXCL9).

Tag Tag Free
Expression Host E. coli
MIG (CXCL9) (NM_002416) Human Over-expression Lysate
LY419335

USD 396.00

In Stock

Transient overexpression lysate of chemokine (C-X-C motif) ligand 9 (CXCL9)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MIG (CXCL9) Rabbit Polyclonal Antibody
TA328386

USD 285.00

5 Days

Anti-Human MIG Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human MIG (CXCL9)
MIG (CXCL9) (NM_002416) Human Recombinant Protein
TP723765

USD 205.00

5 Days

Purified recombinant protein of Human chemokine (C-X-C motif) ligand 9 (CXCL9 / MIG)

Tag Tag Free
Expression Host E. coli
MIG (CXCL9) Rabbit Polyclonal Antibody
TA330378

USD 375.00

5 Days

Rabbit Polyclonal Anti-CXCL9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCL9 antibody: synthetic peptide directed towards the middle region of human CXCL9. Synthetic peptide located within the following region: QTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQ
CXCL9 (23-125, His-tag) Human Protein
AR50988PU-N

USD 845.00

2 Weeks

CXCL9 (23-125, His-tag) human protein, 0.25 mg

Tag His-tag
Expression Host E. coli
CXCL9 (23-125, His-tag) Human Protein
AR50988PU-S

USD 330.00

2 Weeks

CXCL9 (23-125, His-tag) human protein, 50 µg

Tag His-tag
Expression Host E. coli
MIG (CXCL9) (NM_002416) Human Over-expression Lysate
LC419335

USD 121.00

2 Weeks

CXCL9 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
MIG (CXCL9) ICC Control Block
TB410561

USD 1,040.00

4 Weeks

Transient overexpression of CXCL9 (NM_002416) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MIG (CXCL9) (NM_002416) Human Recombinant Protein
TP720369

USD 330.00

3 Weeks

Recombinant protein of human chemokine (C-X-C motif) ligand 9 (CXCL9)

Tag C-His
Expression Host HEK293
MIG (CXCL9) (NM_002416) Human Recombinant Protein
TP720369L

USD 1,900.00

3 Weeks

Recombinant protein of human chemokine (C-X-C motif) ligand 9 (CXCL9)

Tag C-His
Expression Host HEK293
MIG (CXCL9) (NM_002416) Human Recombinant Protein
TP720369M

USD 760.00

3 Weeks

Recombinant protein of human chemokine (C-X-C motif) ligand 9 (CXCL9)

Tag C-His
Expression Host HEK293
MIG (CXCL9) (NM_002416) Human Recombinant Protein
TP720369XL

USD 2,800.00

3 Weeks

Recombinant protein of human chemokine (C-X-C motif) ligand 9 (CXCL9)

Tag C-His
Expression Host HEK293
MIG (CXCL9) Cytosection
TS410561

USD 225.00

4 Weeks

Transient overexpression of CXCL9 (NM_002416) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

MIG (CXCL9) Cytosection
TS410561P5

USD 889.00

4 Weeks

Transient overexpression of CXCL9 (NM_002416) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack