CXCL9 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 9 (CXCL9)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CXCL9 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) ligand 9 (CXCL9)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CXCL9 (untagged)-Human chemokine (C-X-C motif) ligand 9 (CXCL9)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CXCL9 (GFP-tagged) - Human chemokine (C-X-C motif) ligand 9 (CXCL9)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human chemokine (C-X-C motif) ligand 9 (CXCL9), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CXCL9 (Myc-DDK tagged) - Human chemokine (C-X-C motif) ligand 9 (CXCL9), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human chemokine (C-X-C motif) ligand 9 (CXCL9), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CXCL9 (mGFP-tagged) - Human chemokine (C-X-C motif) ligand 9 (CXCL9), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 9 (CXCL9).
Tag | Tag Free |
Expression Host | E. coli |
Transient overexpression lysate of chemokine (C-X-C motif) ligand 9 (CXCL9)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Anti-Human MIG Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human MIG (CXCL9) |
Purified recombinant protein of Human chemokine (C-X-C motif) ligand 9 (CXCL9 / MIG)
Tag | Tag Free |
Expression Host | E. coli |
Rabbit Polyclonal Anti-CXCL9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CXCL9 antibody: synthetic peptide directed towards the middle region of human CXCL9. Synthetic peptide located within the following region: QTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQ |
CXCL9 (23-125, His-tag) human protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
CXCL9 (23-125, His-tag) human protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
CXCL9 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression of CXCL9 (NM_002416) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human chemokine (C-X-C motif) ligand 9 (CXCL9)
Tag | C-His |
Expression Host | HEK293 |
Recombinant protein of human chemokine (C-X-C motif) ligand 9 (CXCL9)
Tag | C-His |
Expression Host | HEK293 |
Recombinant protein of human chemokine (C-X-C motif) ligand 9 (CXCL9)
Tag | C-His |
Expression Host | HEK293 |
Recombinant protein of human chemokine (C-X-C motif) ligand 9 (CXCL9)
Tag | C-His |
Expression Host | HEK293 |
Transient overexpression of CXCL9 (NM_002416) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CXCL9 (NM_002416) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack