MIG (CXCL9) Rabbit Polyclonal Antibody

CAT#: TA330378

Rabbit Polyclonal Anti-CXCL9 Antibody

Product Images

WB Suggested Anti-CXCL9 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CXCL9 antibody: synthetic peptide directed towards the middle region of human CXCL9. Synthetic peptide located within the following region: QTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 12 kDa
• Gene Name: C-X-C motif chemokine ligand 9
• Database Link:
  NP_002407
  Entrez Gene 4283 Human
  UniProt ID Q07325
• Background: The function of CXCL9 has not been specifically defined; however, it is thought to be involved in T cell trafficking. This gene has been localized to 4q21 with INP10, which is also a member of the chemokine family of cytokines.The function of this gene has not been specifically defined; however, it is thought to be involved in T cell trafficking. This gene has been localized to 4q21 with INP10, which is also a member of the chemokine family of cytokines. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: CMK; crg-10; Humig; MIG; SCYB9
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Pig: 91%; Bovine: 90%; Mouse: 83%; Rat: 83%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane
• Protein Pathways: Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Toll-like receptor signaling pathway