CXCR6 (GFP-tagged) - Human chemokine (C-X-C motif) receptor 6 (CXCR6)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
- TrueORF®
CXCR6 (GFP-tagged) - Human chemokine (C-X-C motif) receptor 6 (CXCR6)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CXCR6 (Myc-DDK-tagged)-Human chemokine (C-X-C motif) receptor 6 (CXCR6)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, CXCR6 (Myc-DDK tagged) - Human chemokine (C-X-C motif) receptor 6 (CXCR6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, CXCR6 (mGFP-tagged) - Human chemokine (C-X-C motif) receptor 6 (CXCR6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human chemokine (C-X-C motif) receptor 6 (CXCR6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CXCR6 (Myc-DDK tagged) - Human chemokine (C-X-C motif) receptor 6 (CXCR6), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human chemokine (C-X-C motif) receptor 6 (CXCR6), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, CXCR6 (mGFP-tagged) - Human chemokine (C-X-C motif) receptor 6 (CXCR6), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human chemokine (C-X-C motif) receptor 6 (CXCR6), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CXCR6 (untagged)-Human chemokine (C-X-C motif) receptor 6 (CXCR6)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Bonzo Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bonzo antibody was raised against a peptide corresponding to amino acids near the amino terminus of human Bonzo/STRL33. The sequence of this peptide differs from those of African green monkey and pig-tailed macaque by one or two amino acids, respectively,. |
Lenti ORF clone of Human chemokine (C-X-C motif) receptor 6 (CXCR6), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Bonzo Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bonzo antibody was raised against a peptide corresponding to amino acids 319 to 338 of human origin. The sequence of this peptide is identical to those of macaque and African green monkey. |
Goat Anti-CXCR6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SEDNSKTFSASHN, from the C Terminus of the protein sequence according to NP_006555.1. |
Rabbit Polyclonal Anti-CXCR6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CXCR6 antibody: synthetic peptide directed towards the N terminal of human CXCR6. Synthetic peptide located within the following region: AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL |
Rabbit Polyclonal Anti-CXCR6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CXCR6 |
Transient overexpression of CXCR6 (NM_006564) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CXCR6 (NM_006564) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CXCR6 (NM_006564) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack