Germany
Japan
United Kingdom
China
CRY2 (Myc-DDK-tagged)-Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
CRY2 (Myc-DDK-tagged)-Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, CRY2 (Myc-DDK tagged) - Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CRY2 (mGFP-tagged) - Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
CRY2 (Myc-DDK-tagged)-Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CRY2 (GFP-tagged) - Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CRY2 (Myc-DDK tagged) - Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CRY2 (mGFP-tagged) - Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CRY2 (Myc-DDK-tagged)-Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CRY2 (Myc-DDK-tagged)-Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of CRY2 (mGFP-tagged)-Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CRY2 (mGFP-tagged)-Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CRY2 (GFP-tagged) - Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CRY2 (GFP-tagged) - Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CRY2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-CRY2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRY2 antibody: synthetic peptide directed towards the N terminal of human CRY2. Synthetic peptide located within the following region: IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE |
CRY2 (untagged)-Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
CRY2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of cryptochrome 2 (photolyase-like) (CRY2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
CRY2 MS Standard C13 and N15-labeled recombinant protein (NP_066940)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
CRY2 (untagged)-Human cryptochrome 2 (photolyase-like) (CRY2), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
CRY2 (untagged)-Human cryptochrome 2 (photolyase-like) (CRY2) transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of CRY2 (NM_021117) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CRY2 (NM_001127457) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CRY2 (NM_021117) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CRY2 (NM_021117) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CRY2 (NM_021117) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CRY2 (NM_001127457) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CRY2 (NM_001127457) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CRY2 (NM_021117) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CRY2 (NM_021117) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- CRY2
Pathways
- Circadian rhythm - mammal