USD 98.00
USD 560.00
In Stock
CSNK1D (Myc-DDK-tagged)-Human casein kinase 1, delta (CSNK1D), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 98.00
USD 560.00
In Stock
CSNK1D (Myc-DDK-tagged)-Human casein kinase 1, delta (CSNK1D), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CSNK1D (Myc-DDK-tagged)-Human casein kinase 1, delta (CSNK1D), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CSNK1D (GFP-tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 1,020.00
2 Weeks
Lenti ORF particles, CSNK1D (Myc-DDK tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CSNK1D (GFP-tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 1,020.00
5 Weeks
Lenti ORF particles, CSNK1D (mGFP-tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
USD 820.00
3 Weeks
Lenti ORF particles, CSNK1D (Myc-DDK tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, CSNK1D (mGFP-tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 1,020.00
5 Weeks
Lenti ORF particles, CSNK1D (Myc-DDK tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,020.00
2 Weeks
Lenti ORF particles, CSNK1D (mGFP-tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human casein kinase 1, delta (CSNK1D), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, CSNK1D (Myc-DDK tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human casein kinase 1, delta (CSNK1D), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, CSNK1D (mGFP-tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CSNK1D (untagged)-Human casein kinase 1, delta (CSNK1D), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human casein kinase 1, delta (CSNK1D), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CSNK1D (untagged)-Human casein kinase 1, delta (CSNK1D), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
USD 396.00
In Stock
Transient overexpression lysate of casein kinase 1, delta (CSNK1D), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 768.00
In Stock
Lenti ORF clone of Human casein kinase 1, delta (CSNK1D), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
CSNK1D (untagged)-Kinase deficient mutant (K38M) of Human casein kinase 1, delta (CSNK1D), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CSNK1D (untagged)-Kinase deficient mutant (K38M) of Human casein kinase 1, delta (CSNK1D), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Purified recombinant protein of Human casein kinase 1, delta (CSNK1D), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Goat Polyclonal Antibody against Casein Kinase 1, delta
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DREERLRHSRNPATR, from the internal region of the protein sequence according to NP_001884.2; NP_620693.1. |
USD 396.00
In Stock
Transient overexpression lysate of casein kinase 1, delta (CSNK1D), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 768.00
3 Weeks
Lenti ORF clone of Human casein kinase 1, delta (CSNK1D), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human casein kinase 1, delta (CSNK1D), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Purified recombinant protein of Human casein kinase 1, delta (CSNK1D), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
USD 121.00
In Stock
CSNK1D HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-CSNK1D Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CSNK1D antibody: synthetic peptide directed towards the middle region of human CSNK1D. Synthetic peptide located within the following region: NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR |
Casein kinase I delta (1-409, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
Casein kinase I delta (1-409, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
CSNK1D HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 768.00
In Stock
Lenti ORF clone of Human casein kinase 1, delta (CSNK1D), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-CSNK1D Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CSNK1D |
Transient overexpression of CSNK1D (NM_001893) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CSNK1D (NM_139062) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CSNK1D (NM_001893) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CSNK1D (NM_001893) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CSNK1D (NM_139062) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CSNK1D (NM_139062) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack