Products

View as table Download

JUN (Myc-DDK-tagged)-Human jun proto-oncogene (JUN)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

JUN (untagged)-Human jun proto-oncogene (JUN)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

JUN (GFP-tagged) - Human jun proto-oncogene (JUN)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human jun proto-oncogene (JUN), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human jun proto-oncogene (JUN), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Transient overexpression lysate of jun oncogene (JUN)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-JUN Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human JUN

Rabbit Polyclonal c-jun Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal c-Jun (Ser73) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Jun around the phosphorylation site of Serine 73
Modifications Phospho-specific

Rabbit polyclonal JUN Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 222-251 amino acids from the C-terminal region of human JUN.

Rabbit polyclonal c-Jun (Phospho-Ser63) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of Serine 63.
Modifications Phospho-specific

Rabbit polyclonal Phospho-cJun(S63) Antibody

Applications Dot, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun.
Modifications Phospho-specific

Rabbit polyclonal c-Jun (Phospho-Ser243) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of serine 243 (P-L-SP-P-I).
Modifications Phospho-specific

Rabbit polyclonal c-Jun (Ab-170) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human c-Jun around the phosphorylation site of Tyrosine 170.

c-Jun (JUN) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Bovine, Canine, Drosophila, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus
Immunogen JUN antibody was raised against synthetic peptide derived from the sequence of human c-Jun, conjugated to KLH

AP-1 / c-Jun (1-241, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

AP-1 / c-Jun (1-241, His-tag) human recombinant protein, 10 µg

Tag His-tag
Expression Host E. coli

JUN HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF clone of Human jun proto-oncogene (JUN), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal Phospho-cJun(S63) Antibody

Applications Dot, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun.
Modifications Phospho-specific

Rabbit Polyclonal c-Jun Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Jun

Rabbit Polyclonal c-Jun Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Jun

Rabbit Polyclonal c-Jun (Ser243) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Jun around the phosphorylation site of Serine 243
Modifications Phospho-specific

Rabbit Polyclonal c-Jun (Ser63) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Jun around the phosphorylation site of Serine 63
Modifications Phospho-specific

Rabbit Polyclonal c-Jun (Thr239) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Jun around the phosphorylation site of Threonine 239
Modifications Phospho-specific

Rabbit Polyclonal c-Jun (Thr91) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Jun around the phosphorylation site of Threonine 91
Modifications Phospho-specific

Rabbit Polyclonal c-Jun (Thr93) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Jun around the phosphorylation site of Threonine 93
Modifications Phospho-specific

Rabbit Polyclonal c-Jun (Tyr170) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Jun around the phosphorylation site of Tyrosine 170
Modifications Phospho-specific

Rabbit polyclonal c-Jun (Ab-63) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human c-Jun around the phosphorylation site of Serine 63.

Rabbit polyclonal c-Jun (Ab-243) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human c-Jun around the phosphorylation site of serine 243.

Rabbit Polyclonal Anti-JUN Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP

Rabbit polyclonal JUN Antibody (Center T93)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-98 amino acids from the Central region of human JUN.

JUN Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1G4

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700106

JUN Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2B2

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700107

JUN Capture mouse monoclonal antibody, ELISA validated, clone OTI9A11

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700105

Rabbit Polyclonal c-Jun Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human c-Jun.

Rabbit Polyclonal c-Jun (Ser63) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human c-Jun around the phosphorylation site of Sersine 63.
Modifications Phospho-specific

Mouse Monoclonal c-JUN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated

Mouse monoclonal Anti-Phospho C-Jun (Thr91, Thr93) Clone C-J 4C4/1

Reactivities Human, Rat
Conjugation Unconjugated

Rabbit anti c-Jun Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human c-Jun protein. This sequence is identical within human, rat, mouse, bovine and dog.

Rabbit anti c-Jun(pS63) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope –LTSPD- at a phosphorylation site at serine 63 of human c-Jun protein. This sequence is identical within human, rat, mouse, bovine and dog.

Rabbit anti c-Jun (pT239) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen synthetic peptide corresponding to the epitope –GETPP-at a phosphorylation site Thr 239 of human c-Jun protein. This sequence is identical within human, rat, mouse, bovine and dog.

JUN Capture mouse monoclonal antibody, Luminex validated, clone OTI2E11

Applications LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700108

Carrier-free (BSA/glycerol-free) C-Jun mouse monoclonal antibody, clone OTI1C8 (formerly 1C8)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) JUN mouse monoclonal antibody, clone OTI3G2 (formerly 3G2)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated