Germany
Japan
United Kingdom
China
PROS1 (Myc-DDK-tagged)-Human protein S (alpha) (PROS1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human protein S (alpha) (PROS1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 820.00
3 Weeks
Lenti ORF particles, PROS1 (Myc-DDK tagged) - Human protein S (alpha) (PROS1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, PROS1 (mGFP-tagged) - Human protein S (alpha) (PROS1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PROS1 (untagged)-Human protein S (alpha) (PROS1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
USD 820.00
3 Weeks
Lenti ORF particles, PROS1 (Myc-DDK tagged) - Human protein S (alpha) (PROS1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, PROS1 (mGFP-tagged) - Human protein S (alpha) (PROS1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PROS1 (GFP-tagged) - Human protein S (alpha) (PROS1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human protein S (alpha) (PROS1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of protein S (alpha) (PROS1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human protein S (alpha) (PROS1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Protein S (PROS1) goat polyclonal antibody, Serum
| Applications | ID, IP |
| Reactivities | Human |
| Immunogen | Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Protein S (PROS1) sheep polyclonal antibody, Ig Fraction
| Applications | ELISA, WB |
| Immunogen | Highly pure Protein S, prepared from Human plasma by chromatographic methods |
PROS1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit polyclonal Anti-PROS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PROS1 antibody: synthetic peptide directed towards the middle region of human PROS1. Synthetic peptide located within the following region: MCAQLCVNYPGGYTCYCDGKKGFKLAQDQKSCEVVSVCLPLNLDTKYELL |
Rabbit polyclonal Anti-Pros1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pros1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LGGVPDISFSATPVNAFYSGCMEVNINGVQLDLDEAISKHNDIRAHSCPS |
PROS1 MS Standard C13 and N15-labeled recombinant protein (NP_000304)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Protein S / PROS1 human protein, 50 µg
| Protein Source | Plasma |
Anti-PROS1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 484-666 amino acids of human protein S (alpha) |
Transient overexpression of PROS1 (NM_000313) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PROS1 (NM_000313) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PROS1 (NM_000313) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- PROS1
Pathways
- Complement and coagulation cascades