Products

cDNA Clones (10)
Proteins (7)
Antibodies (3)
Jump to Filters
View as table Download
Heparin Cofactor II (SERPIND1) (NM_000185) Human Tagged ORF Clone
RC206271

USD 420.00

In Stock

SERPIND1 (Myc-DDK-tagged)-Human serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Heparin Cofactor II (SERPIND1) (NM_000185) Human Tagged ORF Clone
RG206271

USD 460.00

In Stock

SERPIND1 (GFP-tagged) - Human serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Heparin Cofactor II (SERPIND1) (NM_000185) Human Tagged ORF Clone Lentiviral Particle
RC206271L3V

USD 820.00

6 Weeks

Lenti ORF particles, SERPIND1 (Myc-DDK tagged) - Human serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Heparin Cofactor II (SERPIND1) (NM_000185) Human Tagged ORF Clone Lentiviral Particle
RC206271L4V

USD 820.00

6 Weeks

Lenti ORF particles, SERPIND1 (mGFP-tagged) - Human serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Heparin Cofactor II (SERPIND1) (NM_000185) Human Mutant ORF Clone
RC401469

USD 760.00

2 Weeks

SERPIND1 Mutant (R208H), Myc-DDK-tagged ORF clone of Homo sapiens serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1) as transfection-ready DNA

Mutation R208H
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Heparin Cofactor II (SERPIND1) (NM_000185) Human Mutant ORF Clone
RC401470

USD 760.00

2 Weeks

SERPIND1 Mutant (E447K), Myc-DDK-tagged ORF clone of Homo sapiens serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1) as transfection-ready DNA

Mutation E447K
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Heparin Cofactor II (SERPIND1) (NM_000185) Human Mutant ORF Clone
RC401471

USD 760.00

2 Weeks

SERPIND1 Mutant (P462L), Myc-DDK-tagged ORF clone of Homo sapiens serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1) as transfection-ready DNA

Mutation P462L
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Heparin Cofactor II (SERPIND1) (NM_000185) Human Untagged Clone
SC120039

USD 310.00

In Stock

SERPIND1 (untagged)-Human serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Heparin Cofactor II (SERPIND1) Rabbit Polyclonal Antibody
TA313999

USD 345.00

In Stock

Rabbit polyclonal Heparin Cofactor II antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Heparin Cofactor II.
Heparin Cofactor II (SERPIND1) Rabbit Polyclonal Antibody
TA332957

USD 275.00

3 Weeks

Rabbit anti-SERPIND1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human SERPIND1
Heparin Cofactor II (SERPIND1) Rabbit Polyclonal Antibody
TA346026

USD 475.00

5 Days

Rabbit Polyclonal Anti-SERPIND1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SERPIND1 antibody: synthetic peptide directed towards the middle region of human SERPIND1. Synthetic peptide located within the following region: VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ
Heparin Cofactor II (SERPIND1) (NM_000185) Human Over-expression Lysate
LC424881

USD 121.00

In Stock

SERPIND1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SERPIND1 (58-499, His-tag) Human Protein
AR51585PU-N

USD 845.00

2 Weeks

SERPIND1 (58-499, His-tag) human protein, 0.5 mg

Tag His-tag
Expression Host E. coli
SERPIND1 (58-499, His-tag) Human Protein
AR51585PU-S

USD 330.00

2 Weeks

SERPIND1 (58-499, His-tag) human protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Heparin Cofactor II (SERPIND1) (NM_000185) Human Over-expression Lysate
LY424881

USD 396.00

5 Days

Transient overexpression lysate of serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Heparin Cofactor II (SERPIND1) ICC Control Block
TB406271

USD 1,070.00

4 Weeks

Transient overexpression of SERPIND1 (NM_000185) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Heparin Cofactor II (SERPIND1) Cytosection
TS406271

USD 225.00

4 Weeks

Transient overexpression of SERPIND1 (NM_000185) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Heparin Cofactor II (SERPIND1) Cytosection
TS406271P5

USD 889.00

4 Weeks

Transient overexpression of SERPIND1 (NM_000185) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack