Germany
Japan
United Kingdom
China
SERPIND1 (Myc-DDK-tagged)-Human serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Serpind1 (Myc-DDK-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade D, member 1 (Serpind1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SERPIND1 (GFP-tagged) - Human serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Serpind1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN515603 is the updated version of KN315603.
Serpind1 (GFP-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade D, member 1 (Serpind1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Serpind1 (Myc-DDK-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade D, member 1 (Serpind1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Serpind1 (Myc-DDK-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade D, member 1 (Serpind1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Serpind1 (mGFP-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade D, member 1 (Serpind1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Serpind1 (GFP-tagged) - Mouse serine (or cysteine) peptidase inhibitor, clade D, member 1 (Serpind1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, SERPIND1 (Myc-DDK tagged) - Human serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, SERPIND1 (mGFP-tagged) - Human serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SERPIND1 Mutant (R208H), Myc-DDK-tagged ORF clone of Homo sapiens serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1) as transfection-ready DNA
| Mutation | R208H |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SERPIND1 Mutant (E447K), Myc-DDK-tagged ORF clone of Homo sapiens serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1) as transfection-ready DNA
| Mutation | E447K |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SERPIND1 Mutant (P462L), Myc-DDK-tagged ORF clone of Homo sapiens serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1) as transfection-ready DNA
| Mutation | P462L |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Serpind1 (Myc-DDK-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade D, member 1 (Serpind1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Serpind1 (Myc-DDK-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade D, member 1 (Serpind1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Serpind1 (Myc-DDK-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade D, member 1 (Serpind1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Serpind1 (mGFP-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade D, member 1 (Serpind1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Serpind1 (GFP-tagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade D, member 1 (Serpind1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SERPIND1 (untagged)-Human serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit anti-SERPIND1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SERPIND1 |
Rabbit Polyclonal Anti-SERPIND1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SERPIND1 antibody: synthetic peptide directed towards the middle region of human SERPIND1. Synthetic peptide located within the following region: VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ |
USD 121.00
In Stock
SERPIND1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Serpind1 (untagged) - Mouse serine (or cysteine) peptidase inhibitor, clade D, member 1 (cDNA clone MGC:18453 IMAGE:4158625), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
SERPIND1 (58-499, His-tag) human protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
SERPIND1 (58-499, His-tag) human protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
For quantitative detection of human Serpin D1 in cell culture supernates, serum and plasma (EDTA, citrate) and urine.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human Serpin D1 |
| Format | 8x12 divisible strips |
| Reactivities | Human |
For quantitative detection of mouse Serpin D1 in cell culture supernates, serum and plasma (EDTA, citrate) and urine.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Mouse Serpin D1 |
| Format | 8x12 divisible strips |
| Reactivities | Mouse |
For quantitative detection of rat Serpin D1 in cell culture supernates, serum and plasma (EDTA, citrate) and urine.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Rat Serpin D1 |
| Format | 8x12 divisible strips |
| Reactivities | Rat |
SERPIND1 CRISPRa kit - CRISPR gene activation of human serpin family D member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Serpind1 CRISPRa kit - CRISPR gene activation of mouse serine (or cysteine) peptidase inhibitor, clade D, member 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene SERPIND1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene SERPIND1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Transient overexpression lysate of serpin peptidase inhibitor, clade D (heparin cofactor), member 1 (SERPIND1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
qSTAR qPCR primer pairs against Mus musculus gene Serpind1
Serpind1 (untagged ORF) - Rat serine (or cysteine) peptidase inhibitor, clade D, member 1 (Serpind1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of serpin peptidase inhibitor clade D (heparin cofactor) member 1 (SERPIND1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
SERPIND1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Serpind1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Serpind1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of SERPIND1 (NM_000185) in HEK293T cells paraffin embedded controls for ICC/IHC staining
SERPIND1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
USD 1,395.00
5 Weeks
SERPIND1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Serpind1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Serpind1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Serpind1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Serpind1 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- SERPIND1