Germany
Japan
United Kingdom
China
GLUD1 (Myc-DDK-tagged)-Human glutamate dehydrogenase 1 (GLUD1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, GLUD1 (Myc-DDK tagged) - Human glutamate dehydrogenase 1 (GLUD1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GLUD1 (mGFP-tagged) - Human glutamate dehydrogenase 1 (GLUD1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GLUD1 (GFP-tagged) - Human glutamate dehydrogenase 1 (GLUD1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human glutamate dehydrogenase 1 (GLUD1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GLUD1 (Myc-DDK tagged) - Human glutamate dehydrogenase 1 (GLUD1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human glutamate dehydrogenase 1 (GLUD1), nuclear gene encoding mitochondrial protein, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GLUD1 (mGFP-tagged) - Human glutamate dehydrogenase 1 (GLUD1), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GLUD1 (untagged)-Human glutamate dehydrogenase 1 (GLUD1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression lysate of glutamate dehydrogenase 1 (GLUD1), nuclear gene encoding mitochondrial protein
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human glutamate dehydrogenase 1 (GLUD1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
GLUD1 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Horse, Human, Monkey, Mouse, Orang-Utan, Pig |
| Conjugation | Unconjugated |
| Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against synthetic peptide C-ESEEQKRNRVRGILR from an internal region of human GLUD1 (NP_005262.1; NP_036216.2). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Panda, Horse, Pig (100%); Rat, Opossum, Pufferfish (93%); Bovine, Xenopus, Stickleback (87%). |
GLUD1 (+Glutamate dehydrogenase 2) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_005262.1; NP_036216.2. |
GLUD1 (untagged)-Human glutamate dehydrogenase 1 (GLUD1), nuclear gene encoding mitochondrial protein
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GLUD1 Rabbit anti-Bovine Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bovine, Human |
| Conjugation | Unconjugated |
| Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against bovine liver glutamate dehydrogenase. |
Rabbit Polyclonal Anti-GLUD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER |
Lenti ORF clone of Human glutamate dehydrogenase 1 (GLUD1), nuclear gene encoding mitochondrial protein, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-GLUD1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: EGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF |
Glutamate dehydrogenase 1 (54-558, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Glutamate dehydrogenase 1 (54-558, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
GLUD1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GLUD1 MS Standard C13 and N15-labeled recombinant protein (NP_005262)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of GLUD1 (NM_005271) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GLUD1 (NM_005271) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GLUD1 (NM_005271) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GLUD1
Pathways
- D-Glutamine and D-glutamate metabolism