Products

Proteins (7)
cDNA Clones (7)
Antibodies (1)
Jump to Filters
View as table Download
CHMP1B (NM_020412) Human Tagged ORF Clone
RC209513

USD 98.00

USD 390.00

In Stock

CHMP1B (Myc-DDK-tagged)-Human chromatin modifying protein 1B (CHMP1B)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CHMP1B (NM_020412) Human Tagged ORF Clone
RG209513

USD 460.00

In Stock

CHMP1B (GFP-tagged) - Human chromatin modifying protein 1B (CHMP1B)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CHMP1B (NM_020412) Human Tagged ORF Clone
RC209513L3

USD 620.00

3 Weeks

Lenti ORF clone of Human chromatin modifying protein 1B (CHMP1B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CHMP1B (NM_020412) Human Tagged ORF Clone
RC209513L4

USD 620.00

3 Weeks

Lenti ORF clone of Human chromatin modifying protein 1B (CHMP1B), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CHMP1B (NM_020412) Human Tagged ORF Clone Lentiviral Particle
RC209513L4V

USD 820.00

6 Weeks

Lenti ORF particles, CHMP1B (mGFP-tagged) - Human chromatin modifying protein 1B (CHMP1B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CHMP1B Rabbit Polyclonal Antibody
TA344782

USD 475.00

5 Days

Rabbit Polyclonal Anti-CHMP1B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHMP1B antibody: synthetic peptide directed towards the N terminal of human CHMP1B. Synthetic peptide located within the following region: KIKKAIQKGNMEVARIHAENAIRQKNQAVNFLRMSARVDAVAARVQTAVT
CHMP1B (NM_020412) Human Untagged Clone
SC127309

USD 310.00

In Stock

CHMP1B (untagged)-Human chromatin modifying protein 1B (CHMP1B)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CHMP1B (NM_020412) Human Over-expression Lysate
LY412493

USD 396.00

5 Days

Transient overexpression lysate of chromatin modifying protein 1B (CHMP1B)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CHMP1B (1-199, His-tag) Human Protein
AR50395PU-N

USD 845.00

2 Weeks

CHMP1B (1-199, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
CHMP1B (1-199, His-tag) Human Protein
AR50395PU-S

USD 330.00

2 Weeks

CHMP1B (1-199, His-tag) human recombinant protein, 20 µg

Tag His-tag
Expression Host E. coli
CHMP1B (NM_020412) Human Over-expression Lysate
LC412493

USD 121.00

2 Weeks

CHMP1B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CHMP1B (NM_020412) ICC Control Block
TB409513

USD 1,040.00

4 Weeks

Transient overexpression of CHMP1B (NM_020412) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CHMP1B Cytosection
TS409513

USD 225.00

4 Weeks

Transient overexpression of CHMP1B (NM_020412) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CHMP1B Cytosection
TS409513P5

USD 889.00

4 Weeks

Transient overexpression of CHMP1B (NM_020412) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack