Products

cDNA Clones (28)
Proteins (20)
Antibodies (2)
Jump to Filters
View as table Download
USP8 (NM_005154) Human Tagged ORF Clone
RC216926

USD 600.00

In Stock

USP8 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
USP8 (NM_001128610) Human Tagged ORF Clone
RC226336

USD 600.00

In Stock

USP8 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
USP8 (NM_001128611) Human Tagged ORF Clone
RC226337

USD 1,170.00

In Stock

USP8 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
USP8 (NM_005154) Human Tagged ORF Clone Lentiviral Particle
RC216926L1V

USD 1,000.00

3 Weeks

Lenti ORF particles, USP8 (Myc-DDK tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
USP8 (NM_005154) Human Tagged ORF Clone Lentiviral Particle
RC216926L2V

USD 1,000.00

6 Weeks

Lenti ORF particles, USP8 (mGFP-tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
USP8 (NM_005154) Human Tagged ORF Clone
RG216926

USD 660.00

In Stock

USP8 (GFP-tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
USP8 (NM_005154) Human Tagged ORF Clone Lentiviral Particle
RC216926L3V

USD 1,000.00

5 Weeks

Lenti ORF particles, USP8 (Myc-DDK tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
USP8 (NM_005154) Human Tagged ORF Clone
RC216926L4

USD 800.00

In Stock

Lenti ORF clone of Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
USP8 (NM_005154) Human Tagged ORF Clone Lentiviral Particle
RC216926L4V

USD 1,000.00

3 Weeks

Lenti ORF particles, USP8 (mGFP-tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
USP8 (NM_001128610) Human Tagged ORF Clone
RC226336L3

USD 800.00

3 Weeks

Lenti-ORF clone of USP8 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
USP8 (NM_001128610) Human Tagged ORF Clone Lentiviral Particle
RC226336L3V

USD 1,000.00

6 Weeks

Lenti ORF particles, USP8 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
USP8 (NM_001128610) Human Tagged ORF Clone
RC226336L4

USD 800.00

3 Weeks

Lenti-ORF clone of USP8 (mGFP-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
USP8 (NM_001128610) Human Tagged ORF Clone Lentiviral Particle
RC226336L4V

USD 1,000.00

6 Weeks

Lenti ORF particles, USP8 (mGFP-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
USP8 (NM_001128611) Human Tagged ORF Clone
RC226337L3

USD 1,370.00

3 Weeks

Lenti-ORF clone of USP8 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
USP8 (NM_001128611) Human Tagged ORF Clone Lentiviral Particle
RC226337L3V

USD 1,570.00

6 Weeks

Lenti ORF particles, USP8 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
USP8 (NM_001128611) Human Tagged ORF Clone
RC226337L4

USD 1,370.00

3 Weeks

Lenti-ORF clone of USP8 (mGFP-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
USP8 (NM_001128611) Human Tagged ORF Clone Lentiviral Particle
RC226337L4V

USD 1,570.00

6 Weeks

Lenti ORF particles, USP8 (mGFP-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
USP8 (NM_001283049) Human Tagged ORF Clone
RC239882

USD 1,060.00

4 Weeks

USP8 (myc-DDK-tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
USP8 (NM_001128610) Human Tagged ORF Clone
RG226336

USD 660.00

3 Weeks

USP8 (GFP-tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
USP8 (NM_001128611) Human Tagged ORF Clone
RG226337

USD 1,290.00

3 Weeks

USP8 (GFP-tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
USP8 (NM_005154) Human Tagged ORF Clone
RC216926L1

USD 984.00

In Stock

Lenti ORF clone of Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
USP8 (NM_005154) Human Untagged Clone
SC125502

USD 1,100.00

In Stock

USP8 (untagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC125502 is the updated version of SC125418.
USP8 (NM_005154) Human Tagged ORF Clone
RC216926L3

USD 984.00

3 Weeks

Lenti ORF clone of Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
USP8 Rabbit Polyclonal Antibody
TA342558

USD 375.00

5 Days

Rabbit Polyclonal Anti-USP8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP8 antibody: synthetic peptide directed towards the C terminal of human USP8. Synthetic peptide located within the following region: FAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHA
USP8 (NM_005154) Human Tagged ORF Clone
RC216926L2

USD 800.00

3 Weeks

Lenti ORF clone of Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
USP8 (NM_005154) Human Over-expression Lysate
LY417494

USD 605.00

5 Days

Transient overexpression lysate of ubiquitin specific peptidase 8 (USP8), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
USP8 (NM_001128610) Human Untagged Clone
SC323258

USD 1,100.00

2 Weeks

USP8 (untagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
USP8 Rabbit Polyclonal Antibody
TA342559

USD 375.00

5 Days

Rabbit Polyclonal Anti-USP8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP8 antibody: synthetic peptide directed towards the N terminal of human USP8. Synthetic peptide located within the following region: KGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLI
USP8 (NM_005154) Human Over-expression Lysate
LC417494

USD 187.00

2 Weeks

USP8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
USP8 (NM_001128610) Human Over-expression Lysate
LC426972

USD 187.00

2 Weeks

USP8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
USP8 (NM_001128611) Human Over-expression Lysate
LC426973

USD 187.00

2 Weeks

USP8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
USP8 (NM_001128610) Human Over-expression Lysate
LY426972

USD 605.00

5 Days

Transient overexpression lysate of ubiquitin specific peptidase 8 (USP8), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
USP8 (NM_001128611) Human Over-expression Lysate
LY426973

USD 605.00

5 Days

Transient overexpression lysate of ubiquitin specific peptidase 8 (USP8), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
USP8 (NM_005154) Human Mass Spec Standard
PH316926

USD 2,055.00

3 Weeks

USP8 MS Standard C13 and N15-labeled recombinant protein (NP_005145)

Tag C-Myc/DDK
Expression Host HEK293
USP8 (NM_001128610) Human Mass Spec Standard
PH326336

USD 2,055.00

3 Weeks

USP8 MS Standard C13 and N15-labeled recombinant protein (NP_001122082)

Tag C-Myc/DDK
Expression Host HEK293
USP8 (NM_001128611) Human Mass Spec Standard
PH326337

USD 2,055.00

3 Weeks

USP8 MS Standard C13 and N15-labeled recombinant protein (NP_001122083)

Tag C-Myc/DDK
Expression Host HEK293
USP8 (NM_001283049) Human Tagged ORF Clone
RG239882

USD 1,100.00

2 Weeks

USP8 (GFP-tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
USP8 (NM_001128611) Human Untagged Clone
SC323259

USD 1,100.00

2 Weeks

USP8 (untagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 3

Vector pCMV6 series
Tag Tag Free
USP8 (NM_001283049) Human Untagged Clone
SC337776

USD 1,030.00

4 Weeks

USP8 (untagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 4

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
USP8 (NM_005154) ICC Control Block
TB416926

USD 1,250.00

4 Weeks

Transient overexpression of USP8 (NM_005154) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USP8 (NM_001128610) ICC Control Block
TB426336

USD 1,250.00

4 Weeks

Transient overexpression of USP8 (NM_001128610) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USP8 (NM_001128611) ICC Control Block
TB426337

USD 1,820.00

4 Weeks

Transient overexpression of USP8 (NM_001128611) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USP8 (NM_001283049) ICC Control Block
TB439882

USD 1,710.00

4 Weeks

Transient overexpression of USP8 (NM_001283049) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USP8 Cytosection
TS416926

USD 225.00

4 Weeks

Transient overexpression of USP8 (NM_005154) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USP8 Cytosection
TS416926P5

USD 889.00

4 Weeks

Transient overexpression of USP8 (NM_005154) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USP8 Cytosection
TS426336

USD 225.00

4 Weeks

Transient overexpression of USP8 (NM_001128610) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USP8 Cytosection
TS426336P5

USD 889.00

4 Weeks

Transient overexpression of USP8 (NM_001128610) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USP8 Cytosection
TS426337

USD 225.00

4 Weeks

Transient overexpression of USP8 (NM_001128611) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USP8 ICC Control Sections
TS426337P5

USD 889.00

4 Weeks

Transient overexpression of USP8 (NM_001128611) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USP8 ICC Control Sections
TS439882P5

USD 889.00

4 Weeks

Transient overexpression of USP8 (NM_001283049) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack