Products

cDNA Clones (23)
Proteins (17)
Antibodies (8)
Jump to Filters
View as table Download
VPS28 (NM_016208) Human Tagged ORF Clone
RC200025

USD 98.00

USD 390.00

In Stock

VPS28 (Myc-DDK-tagged)-Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
VPS28 (NM_183057) Human Tagged ORF Clone
RC208726

USD 98.00

USD 390.00

In Stock

VPS28 (Myc-DDK-tagged)-Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
VPS28 (NM_016208) Human Recombinant Protein
TP300025

USD 823.00

In Stock

Recombinant protein of human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
VPS28 (NM_016208) Human Tagged ORF Clone Lentiviral Particle
RC200025L1V

USD 1,020.00

5 Weeks

Lenti ORF particles, VPS28 (Myc-DDK tagged) - Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
VPS28 (NM_016208) Human Tagged ORF Clone Lentiviral Particle
RC200025L2V

USD 1,020.00

5 Weeks

Lenti ORF particles, VPS28 (mGFP-tagged) - Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
VPS28 (NM_183057) Human Tagged ORF Clone Lentiviral Particle
RC208726L1V

USD 820.00

3 Weeks

Lenti ORF particles, VPS28 (Myc-DDK tagged) - Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
VPS28 (NM_183057) Human Tagged ORF Clone Lentiviral Particle
RC208726L2V

USD 820.00

6 Weeks

Lenti ORF particles, VPS28 (mGFP-tagged) - Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
VPS28 (NM_183057) Human Recombinant Protein
TP308726

USD 823.00

In Stock

Recombinant protein of human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
VPS28 (NM_016208) Human Tagged ORF Clone
RG200025

USD 460.00

In Stock

VPS28 (GFP-tagged) - Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
VPS28 (NM_183057) Human Tagged ORF Clone
RG208726

USD 460.00

In Stock

VPS28 (GFP-tagged) - Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
VPS28 (NM_016208) Human Tagged Lenti ORF Clone
RC200025L3

USD 768.00

3 Weeks

Lenti ORF clone of Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS28 (NM_016208) Human Tagged ORF Clone Lentiviral Particle
RC200025L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, VPS28 (Myc-DDK tagged) - Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS28 (NM_016208) Human Tagged Lenti ORF Clone
RC200025L4

USD 768.00

3 Weeks

Lenti ORF clone of Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS28 (NM_016208) Human Tagged ORF Clone Lentiviral Particle
RC200025L4V

USD 1,020.00

5 Weeks

Lenti ORF particles, VPS28 (mGFP-tagged) - Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS28 (NM_183057) Human Tagged ORF Clone
RC208726L3

USD 620.00

3 Weeks

Lenti ORF clone of Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS28 (NM_183057) Human Tagged ORF Clone Lentiviral Particle
RC208726L3V

USD 820.00

5 Weeks

Lenti ORF particles, VPS28 (Myc-DDK tagged) - Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS28 (NM_183057) Human Tagged ORF Clone
RC208726L4

USD 620.00

3 Weeks

Lenti ORF clone of Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS28 (NM_183057) Human Tagged ORF Clone Lentiviral Particle
RC208726L4V

USD 820.00

7 Weeks

Lenti ORF particles, VPS28 (mGFP-tagged) - Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS28 Rabbit Polyclonal Antibody
TA345056

USD 475.00

5 Days

Rabbit Polyclonal Anti-VPS28 Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-VPS28 antibody: synthetic peptide directed towards the N terminal of human VPS28. Synthetic peptide located within the following region: MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ
VPS28 (1-221) Human Protein
AR09283PU-L

USD 620.00

2 Weeks

VPS28 (1-221) human recombinant protein, 0.5 mg

Expression Host E. coli
VPS28 (1-221) Human Protein
AR09283PU-N

USD 260.00

2 Weeks

VPS28 (1-221) human recombinant protein, 0.1 mg

Expression Host E. coli
VPS28 (NM_183057) Human Tagged ORF Clone
RC208726L1

USD 620.00

In Stock

Lenti ORF clone of Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
VPS28 Goat Polyclonal Antibody
TA302924

USD 375.00

In Stock

Goat Polyclonal Antibody against VPS28

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ESAYNAFNRFLHA, from the C Terminus of the protein sequence according to NP_057292.1.
VPS28 (NM_016208) Human Tagged Lenti ORF Clone
RC200025L1

USD 768.00

3 Weeks

Lenti ORF clone of Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
VPS28 (NM_016208) Human Tagged Lenti ORF Clone
RC200025L2

USD 768.00

3 Weeks

Lenti ORF clone of Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
VPS28 (NM_183057) Human Tagged ORF Clone
RC208726L2

USD 620.00

3 Weeks

Lenti ORF clone of Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
VPS28 (NM_183057) Human Untagged Clone
SC321875

USD 420.00

In Stock

VPS28 (untagged)-Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
VPS28 (NM_016208) Human Over-expression Lysate
LC414122

USD 121.00

In Stock

VPS28 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
VPS28 (NM_016208) Human Untagged Clone
SC114425

USD 310.00

In Stock

VPS28 (untagged)-Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
VPS28 (NM_016208) Human Recombinant Protein
TP761364

USD 215.00

In Stock

Purified recombinant protein of Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
VPS28 Mouse Monoclonal Antibody [Clone ID: OTI1A8]
CF505691

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) VPS28 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
VPS28 (NM_183057) Human Over-expression Lysate
LC405220

USD 121.00

2 Weeks

VPS28 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
VPS28 (NM_016208) Human Mass Spec Standard
PH300025

USD 2,055.00

3 Weeks

VPS28 MS Standard C13 and N15-labeled recombinant protein (NP_057292)

Tag C-Myc/DDK
Expression Host HEK293
VPS28 (NM_183057) Human Mass Spec Standard
PH308726

USD 2,055.00

3 Weeks

VPS28 MS Standard C13 and N15-labeled recombinant protein (NP_898880)

Tag C-Myc/DDK
Expression Host HEK293
VPS28 (AK091979) Human Untagged Clone
SC311808

USD 960.00

3 Weeks

(untagged)-Human cDNA FLJ34660 fis, clone KIDNE2018891, highly similar to Human VPS28 protein mRNA

Vector pCMV6 series
Tag Tag Free
VPS28 Rabbit Polyclonal Antibody
TA350605

USD 345.00

In Stock

Rabbit Polyclonal Anti-VPS28 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
VPS28 Mouse Monoclonal Antibody [Clone ID: OTI1A8]
TA505691

USD 379.00

In Stock

VPS28 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
VPS28 Mouse Monoclonal Antibody [Clone ID: OTI1A8]
TA505691S

USD 159.00

In Stock

VPS28 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
VPS28 (NM_016208) ICC Control Block
TB400025

USD 1,040.00

4 Weeks

Transient overexpression of VPS28 (NM_016208) in HEK293T cells paraffin embedded controls for ICC/IHC staining

VPS28 (NM_183057) ICC Control Block
TB408726

USD 1,040.00

4 Weeks

Transient overexpression of VPS28 (NM_183057) in HEK293T cells paraffin embedded controls for ICC/IHC staining

VPS28 Cytosection
TS400025

USD 225.00

4 Weeks

Transient overexpression of VPS28 (NM_016208) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

VPS28 Cytosection
TS400025P5

USD 889.00

4 Weeks

Transient overexpression of VPS28 (NM_016208) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

VPS28 Cytosection
TS408726

USD 225.00

4 Weeks

Transient overexpression of VPS28 (NM_183057) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

VPS28 Cytosection
TS408726P5

USD 889.00

4 Weeks

Transient overexpression of VPS28 (NM_183057) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack