Products

cDNA Clones (19)
Proteins (11)
Antibodies (2)
Jump to Filters
View as table Download
VPS37A (NM_152415) Human Tagged ORF Clone
RC209716

USD 420.00

In Stock

VPS37A (Myc-DDK-tagged)-Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
VPS37A (NM_001145152) Human Tagged ORF Clone
RC227139

USD 98.00

USD 460.00

In Stock

VPS37A (Myc-DDK-tagged)-Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
VPS37A (NM_152415) Human Tagged ORF Clone Lentiviral Particle
RC209716L1V

USD 820.00

6 Weeks

Lenti ORF particles, VPS37A (Myc-DDK tagged) - Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
VPS37A (NM_152415) Human Tagged ORF Clone Lentiviral Particle
RC209716L2V

USD 820.00

6 Weeks

Lenti ORF particles, VPS37A (mGFP-tagged) - Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
VPS37A (NM_152415) Human Tagged ORF Clone
RG209716

USD 460.00

2 Weeks

VPS37A (GFP-tagged) - Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
VPS37A (NM_152415) Human Tagged ORF Clone
RC209716L3

USD 620.00

3 Weeks

Lenti ORF clone of Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS37A (NM_152415) Human Tagged ORF Clone Lentiviral Particle
RC209716L3V

USD 820.00

6 Weeks

Lenti ORF particles, VPS37A (Myc-DDK tagged) - Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS37A (NM_152415) Human Tagged ORF Clone
RC209716L4

USD 620.00

3 Weeks

Lenti ORF clone of Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS37A (NM_152415) Human Tagged ORF Clone Lentiviral Particle
RC209716L4V

USD 820.00

6 Weeks

Lenti ORF particles, VPS37A (mGFP-tagged) - Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS37A (NM_001145152) Human Tagged ORF Clone
RC227139L3

USD 620.00

3 Weeks

Lenti ORF clone of Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS37A (NM_001145152) Human Tagged ORF Clone Lentiviral Particle
RC227139L3V

USD 820.00

6 Weeks

Lenti ORF particles, VPS37A (Myc-DDK tagged) - Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS37A (NM_001145152) Human Tagged ORF Clone
RC227139L4

USD 620.00

3 Weeks

Lenti ORF clone of Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS37A (NM_001145152) Human Tagged ORF Clone Lentiviral Particle
RC227139L4V

USD 820.00

6 Weeks

Lenti ORF particles, VPS37A (mGFP-tagged) - Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
VPS37A (NM_001145152) Human Tagged ORF Clone
RG227139

USD 460.00

3 Weeks

VPS37A (GFP-tagged) - Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
VPS37A (NM_152415) Human Tagged ORF Clone
RC209716L2

USD 620.00

2 Weeks

Lenti ORF clone of Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
VPS37A (NM_152415) Human Tagged ORF Clone
RC209716L1

USD 620.00

3 Weeks

Lenti ORF clone of Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
VPS37A (NM_152415) Human Untagged Clone
SC322101

USD 760.00

In Stock

VPS37A (untagged)-Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
VPS37A (NM_152415) Human Recombinant Protein
TP761670

USD 215.00

In Stock

Purified recombinant protein of Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
VPS37A (NM_152415) Human Over-expression Lysate
LY407583

USD 396.00

5 Days

Transient overexpression lysate of vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
VPS37A Rabbit Polyclonal Antibody
TA338843

USD 375.00

5 Days

Rabbit Polyclonal Anti-VPS37A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VPS37A antibody: synthetic peptide directed towards the N terminal of human VPS37A. Synthetic peptide located within the following region: SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVE
VPS37A (NM_152415) Human Over-expression Lysate
LC407583

USD 121.00

2 Weeks

VPS37A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
VPS37A (NM_001145152) Human Over-expression Lysate
LC428727

USD 121.00

2 Weeks

VPS37A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
VPS37A (NM_001145152) Human Over-expression Lysate
LY428727

USD 396.00

5 Days

Transient overexpression lysate of vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
VPS37A (NM_152415) Human Untagged Clone
SC100587

USD 760.00

4 Weeks

VPS37A (untagged)-Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
VPS37A (NM_001145152) Human Untagged Clone
SC325838

USD 640.00

3 Weeks

VPS37A (untagged)-Human vacuolar protein sorting 37 homolog A (S. cerevisiae) (VPS37A), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
VPS37A Rabbit Polyclonal Antibody
TA350614

USD 345.00

In Stock

Rabbit Polyclonal Anti-VPS37A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human VPS37A
VPS37A (NM_152415) ICC Control Block
TB409716

USD 1,070.00

4 Weeks

Transient overexpression of VPS37A (NM_152415) in HEK293T cells paraffin embedded controls for ICC/IHC staining

VPS37A (NM_001145152) ICC Control Block
TB427139

USD 1,110.00

4 Weeks

Transient overexpression of VPS37A (NM_001145152) in HEK293T cells paraffin embedded controls for ICC/IHC staining

VPS37A Cytosection
TS409716

USD 225.00

4 Weeks

Transient overexpression of VPS37A (NM_152415) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

VPS37A Cytosection
TS409716P5

USD 889.00

4 Weeks

Transient overexpression of VPS37A (NM_152415) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

VPS37A Cytosection
TS427139

USD 225.00

4 Weeks

Transient overexpression of VPS37A (NM_001145152) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

VPS37A Cytosection
TS427139P5

USD 889.00

4 Weeks

Transient overexpression of VPS37A (NM_001145152) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack