Germany
Japan
United Kingdom
China
Lenti ORF particles, ATP6V0A2 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a2 (ATP6V0A2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Products
View as table DownloadLenti ORF particles, ATP6V0A2 (mGFP-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a2 (ATP6V0A2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ATP6V0A2 (GFP-tagged) - Human ATPase, H+ transporting, lysosomal V0 subunit a2 (ATP6V0A2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATP6V0A2 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a2 (ATP6V0A2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of ATP6V0A2 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a2 (ATP6V0A2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ATP6V0A2 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a2 (ATP6V0A2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ATP6V0A2 (mGFP-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a2 (ATP6V0A2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ATP6V0A2 (mGFP-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a2 (ATP6V0A2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-ATP6V0A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
ATP6V0A2 (untagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a2 (ATP6V0A2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti-ORF clone of ATP6V0A2 (Myc-DDK-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a2 (ATP6V0A2)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of ATP6V0A2 (mGFP-tagged)-Human ATPase, H+ transporting, lysosomal V0 subunit a2 (ATP6V0A2)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
(untagged)-Human cDNA FLJ32238 fis, clone PLACE6004993
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal antibody to ATP6V0A2 (ATPase, H+ transporting, lysosomal V0 subunit a2)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 156 and 434 of ATP6V0A2 (Uniprot ID#Q9Y487) |
Transient overexpression of ATP6V0A2 (NM_012463) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATP6V0A2 (NM_012463) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ATP6V0A2 (NM_012463) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ATP6V0A2
Pathways
- Epithelial cell signaling in Helicobacter pylori infection