Germany
Japan
United Kingdom
China
Lenti ORF particles, SHC3 (Myc-DDK-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Products
View as table DownloadLenti ORF particles, SHC3 (mGFP-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
SHC3 (Myc-DDK-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of SHC3 (Myc-DDK-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SHC3 (Myc-DDK-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of SHC3 (mGFP-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, SHC3 (mGFP-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
SHC3 (GFP-tagged) - Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
SHC3 (untagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti-ORF clone of SHC3 (Myc-DDK-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3)
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-SHC3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHC3 antibody: synthetic peptide directed towards the middle region of human SHC3. Synthetic peptide located within the following region: RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST |
Rabbit Polyclonal Anti-SHC3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Shc3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIANHHMRSIS |
Lenti-ORF clone of SHC3 (mGFP-tagged)-Human SHC (Src homology 2 domain containing) transforming protein 3 (SHC3)
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal SHC3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SHC3. |
Transient overexpression of SHC3 (NM_016848) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of SHC3 (NM_016848) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SHC3 (NM_016848) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- SHC3
Pathways
- ErbB signaling pathway