Germany
Japan
United Kingdom
China
ACTN2 (Myc-DDK-tagged)-Human actinin, alpha 2 (ACTN2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human actinin, alpha 2 (ACTN2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ACTN2 (GFP-tagged) - Human actinin, alpha 2 (ACTN2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, ACTN2 (Myc-DDK tagged) - Human actinin, alpha 2 (ACTN2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ACTN2 (mGFP-tagged) - Human actinin, alpha 2 (ACTN2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF particles, ACTN2 (Myc-DDK tagged) - Human actinin, alpha 2 (ACTN2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human actinin, alpha 2 (ACTN2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ACTN2 (mGFP-tagged) - Human actinin, alpha 2 (ACTN2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ACTN2 (myc-DDK-tagged) - Human actinin, alpha 2 (ACTN2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACTN2 (myc-DDK-tagged) - Human actinin, alpha 2 (ACTN2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human actinin, alpha 2 (ACTN2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
ACTN2 (untagged)-Human actinin, alpha 2 (ACTN2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD |
Lenti ORF clone of Human actinin, alpha 2 (ACTN2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-Actinin a 2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Actinin a 2/3 Antibody: A synthesized peptide derived from human Actinin a 2/3 |
Lenti ORF clone of Human actinin, alpha 2 (ACTN2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ACTN2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of actinin, alpha 2 (ACTN2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ACTN2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 750-779 amino acids from the C-terminal region of human ACTN2 |
ACTN2 MS Standard C13 and N15-labeled recombinant protein (NP_001094)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ACTN2 (GFP-tagged) - Human actinin, alpha 2 (ACTN2), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACTN2 (GFP-tagged) - Human actinin, alpha 2 (ACTN2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ACTN2 (untagged) - Human actinin, alpha 2 (ACTN2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ACTN2 (untagged) - Human actinin, alpha 2 (ACTN2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of ACTN2 (NM_001103) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACTN2 (NM_001278344) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACTN2 (NM_001278343) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACTN2 (NM_001103) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACTN2 (NM_001103) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ACTN2 (NM_001278344) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ACTN2 (NM_001278343) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ACTN2
Pathways
- Focal adhesion