LAMC3 (Myc-DDK-tagged)-Human laminin, gamma 3 (LAMC3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LAMC3 (Myc-DDK-tagged)-Human laminin, gamma 3 (LAMC3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human laminin, gamma 3 (LAMC3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 2,050.00
6 Weeks
Lenti ORF particles, LAMC3 (Myc-DDK tagged) - Human laminin, gamma 3 (LAMC3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human laminin, gamma 3 (LAMC3), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 2,050.00
6 Weeks
Lenti ORF particles, LAMC3 (mGFP-tagged) - Human laminin, gamma 3 (LAMC3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
LAMC3 (GFP-tagged) - Human laminin, gamma 3 (LAMC3)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-LAMC3 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMC3. |
LAMC3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-LAMC3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LAMC3 antibody is: synthetic peptide directed towards the C-terminal region of Human LAMC3. Synthetic peptide located within the following region: ERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLRERKQAHRRASRLT |
Transient overexpression lysate of laminin, gamma 3 (LAMC3)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
LAMC3 MS Standard C13 and N15-labeled recombinant protein (NP_006050)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
LAMC3 (untagged)-Human laminin, gamma 3 (LAMC3)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of LAMC3 (NM_006059) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LAMC3 (NM_006059) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LAMC3 (NM_006059) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack