Products

cDNA Clones (22)
Proteins (19)
Antibodies (1)
Jump to Filters
View as table Download
Parvin gamma (PARVG) (NM_022141) Human Tagged ORF Clone
RC206755L4

USD 620.00

3 Weeks

Lenti ORF clone of Human parvin, gamma (PARVG), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Parvin gamma (PARVG) (NM_001137605) Human Tagged ORF Clone Lentiviral Particle
RC226988L3V

USD 820.00

6 Weeks

Lenti ORF particles, PARVG (Myc-DDK tagged) - Human parvin, gamma (PARVG), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Parvin gamma (PARVG) (NM_001137606) Human Tagged ORF Clone Lentiviral Particle
RC227051L3V

USD 820.00

6 Weeks

Lenti ORF particles, PARVG (Myc-DDK tagged) - Human parvin, gamma (PARVG), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Parvin gamma (PARVG) (NM_022141) Human Tagged ORF Clone
RG206755

USD 460.00

3 Weeks

PARVG (GFP-tagged) - Human parvin, gamma (PARVG), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Parvin gamma (PARVG) (NM_001137605) Human Tagged ORF Clone
RG226988

USD 460.00

3 Weeks

PARVG (GFP-tagged) - Human parvin, gamma (PARVG), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Parvin gamma (PARVG) (NM_001137606) Human Tagged ORF Clone
RG227051

USD 460.00

3 Weeks

PARVG (GFP-tagged) - Human parvin, gamma (PARVG), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Parvin gamma (PARVG) Rabbit Polyclonal Antibody
TA344693

USD 475.00

5 Days

Rabbit Polyclonal Anti-PARVG Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PARVG antibody is: synthetic peptide directed towards the N-terminal region of Human PARVG. Synthetic peptide located within the following region: RKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAA
Parvin gamma (PARVG) (NM_022141) Human Untagged Clone
SC324679

USD 660.00

In Stock

PARVG (untagged)-Human parvin, gamma (PARVG), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Parvin gamma (PARVG) (NM_022141) Human Over-expression Lysate
LC411746

USD 121.00

2 Weeks

PARVG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Parvin gamma (PARVG) (NM_001137605) Human Over-expression Lysate
LC427944

USD 121.00

2 Weeks

PARVG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Parvin gamma (PARVG) (NM_001137606) Human Over-expression Lysate
LC427945

USD 121.00

2 Weeks

PARVG HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Parvin gamma (PARVG) (NM_022141) Human Over-expression Lysate
LY411746

USD 396.00

5 Days

Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Parvin gamma (PARVG) (NM_001137605) Human Over-expression Lysate
LY427944

USD 396.00

5 Days

Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Parvin gamma (PARVG) (NM_001137606) Human Over-expression Lysate
LY427945

USD 396.00

5 Days

Transient overexpression lysate of parvin, gamma (PARVG), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Parvin gamma (PARVG) (NM_022141) Human Mass Spec Standard
PH306755

USD 2,055.00

3 Weeks

PARVG MS Standard C13 and N15-labeled recombinant protein (NP_071424)

Tag C-Myc/DDK
Expression Host HEK293
Parvin gamma (PARVG) (NM_001137605) Human Mass Spec Standard
PH326988

USD 2,055.00

3 Weeks

PARVG MS Standard C13 and N15-labeled recombinant protein (NP_001131077)

Tag C-Myc/DDK
Expression Host HEK293
Parvin gamma (PARVG) (NM_001137606) Human Mass Spec Standard
PH327051

USD 2,055.00

3 Weeks

PARVG MS Standard C13 and N15-labeled recombinant protein (NP_001131078)

Tag C-Myc/DDK
Expression Host HEK293
Parvin gamma (PARVG) (NM_022141) Human Untagged Clone
SC112813

USD 660.00

4 Weeks

PARVG (untagged)-Human parvin, gamma (PARVG), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Parvin gamma (PARVG) (NM_001137605) Human Untagged Clone
SC324949

USD 660.00

3 Weeks

PARVG (untagged)-Human parvin, gamma (PARVG), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Parvin gamma (PARVG) (NM_001137606) Human Untagged Clone
SC324950

USD 660.00

3 Weeks

PARVG (untagged)-Human parvin, gamma (PARVG), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Parvin gamma (PARVG) (NM_022141) ICC Control Block
TB406755

USD 1,070.00

4 Weeks

Transient overexpression of PARVG (NM_022141) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Parvin gamma (PARVG) (NM_001137605) ICC Control Block
TB426988

USD 1,070.00

4 Weeks

Transient overexpression of PARVG (NM_001137605) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Parvin gamma (PARVG) (NM_001137606) ICC Control Block
TB427051

USD 1,070.00

4 Weeks

Transient overexpression of PARVG (NM_001137606) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Parvin gamma (PARVG) Cytosection
TS406755

USD 225.00

4 Weeks

Transient overexpression of PARVG (NM_022141) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Parvin gamma (PARVG) Cytosection
TS406755P5

USD 889.00

4 Weeks

Transient overexpression of PARVG (NM_022141) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Parvin gamma (PARVG) Cytosection
TS426988

USD 225.00

4 Weeks

Transient overexpression of PARVG (NM_001137605) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Parvin gamma (PARVG) Cytosection
TS426988P5

USD 889.00

4 Weeks

Transient overexpression of PARVG (NM_001137605) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Parvin gamma (PARVG) Cytosection
TS427051

USD 225.00

4 Weeks

Transient overexpression of PARVG (NM_001137606) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Parvin gamma (PARVG) ICC Control Sections
TS427051P5

USD 889.00

4 Weeks

Transient overexpression of PARVG (NM_001137606) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack