Products

cDNA Clones (23)
Proteins (14)
Antibodies (3)
Jump to Filters
View as table Download
Casein Kinase 1 delta (CSNK1D) (NM_001893) Human Tagged ORF Clone
RC200482

USD 98.00

USD 560.00

In Stock

CSNK1D (Myc-DDK-tagged)-Human casein kinase 1, delta (CSNK1D), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Casein Kinase 1 delta (CSNK1D) (NM_001893) Human Tagged ORF Clone
RG200482

USD 460.00

In Stock

CSNK1D (GFP-tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Casein Kinase 1 delta (CSNK1D) (NM_001893) Human Tagged ORF Clone Lentiviral Particle
RC200482L1V

USD 1,020.00

2 Weeks

Lenti ORF particles, CSNK1D (Myc-DDK tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Casein Kinase 1 delta (CSNK1D) (NM_139062) Human Tagged ORF Clone
RG204965

USD 460.00

In Stock

CSNK1D (GFP-tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Casein Kinase 1 delta (CSNK1D) (NM_001893) Human Tagged ORF Clone Lentiviral Particle
RC200482L3V

USD 1,020.00

5 Weeks

Lenti ORF particles, CSNK1D (Myc-DDK tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Casein Kinase 1 delta (CSNK1D) (NM_001893) Human Tagged ORF Clone Lentiviral Particle
RC200482L4V

USD 1,020.00

2 Weeks

Lenti ORF particles, CSNK1D (mGFP-tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Casein Kinase 1 delta (CSNK1D) (NM_139062) Human Tagged ORF Clone Lentiviral Particle
RC204965L3V

USD 820.00

5 Weeks

Lenti ORF particles, CSNK1D (Myc-DDK tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Casein Kinase 1 delta (CSNK1D) (NM_139062) Human Tagged ORF Clone Lentiviral Particle
RC204965L4V

USD 820.00

7 Weeks

Lenti ORF particles, CSNK1D (mGFP-tagged) - Human casein kinase 1, delta (CSNK1D), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Casein Kinase 1 delta (CSNK1D) (NM_139062) Human Untagged Clone
SC125335

USD 310.00

In Stock

CSNK1D (untagged)-Human casein kinase 1, delta (CSNK1D), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Casein Kinase 1 delta (CSNK1D) (NM_001893) Human Untagged Clone
SC319469

USD 760.00

In Stock

CSNK1D (untagged)-Human casein kinase 1, delta (CSNK1D), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Casein Kinase 1 delta (CSNK1D) (NM_139062) Human Over-expression Lysate
LY408409

USD 396.00

In Stock

Transient overexpression lysate of casein kinase 1, delta (CSNK1D), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Casein Kinase 1 delta (CSNK1D) (NM_139062) Human Untagged Clone
SC323403

USD 760.00

In Stock

CSNK1D (untagged)-Kinase deficient mutant (K38M) of Human casein kinase 1, delta (CSNK1D), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Casein Kinase 1 delta (CSNK1D) (NM_001893) Human Untagged Clone
SC323472

USD 760.00

In Stock

CSNK1D (untagged)-Kinase deficient mutant (K38M) of Human casein kinase 1, delta (CSNK1D), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Casein Kinase 1 delta (CSNK1D) (NM_001893) Human Recombinant Protein
TP760527

USD 215.00

In Stock

Purified recombinant protein of Human casein kinase 1, delta (CSNK1D), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
Casein Kinase 1 delta (CSNK1D) Goat Polyclonal Antibody
TA302441

USD 375.00

In Stock

Goat Polyclonal Antibody against Casein Kinase 1, delta

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DREERLRHSRNPATR, from the internal region of the protein sequence according to NP_001884.2; NP_620693.1.
Casein Kinase 1 delta (CSNK1D) (NM_001893) Human Over-expression Lysate
LY400705

USD 396.00

In Stock

Transient overexpression lysate of casein kinase 1, delta (CSNK1D), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Casein Kinase 1 delta (CSNK1D) (NM_139062) Human Tagged ORF Clone
RC204965L2

USD 620.00

3 Weeks

Lenti ORF clone of Human casein kinase 1, delta (CSNK1D), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Casein Kinase 1 delta (CSNK1D) (NM_139062) Human Recombinant Protein
TP760561

USD 215.00

In Stock

Purified recombinant protein of Human casein kinase 1, delta (CSNK1D), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli
Casein Kinase 1 delta (CSNK1D) Rabbit Polyclonal Antibody
TA340031

USD 375.00

5 Days

Rabbit Polyclonal Anti-CSNK1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1D antibody: synthetic peptide directed towards the middle region of human CSNK1D. Synthetic peptide located within the following region: NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR
Casein kinase I delta (1-409, His-tag) Human Protein
AR51510PU-N

USD 845.00

2 Weeks

Casein kinase I delta (1-409, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Casein kinase I delta (1-409, His-tag) Human Protein
AR51510PU-S

USD 330.00

2 Weeks

Casein kinase I delta (1-409, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Casein Kinase 1 delta (CSNK1D) (NM_139062) Human Over-expression Lysate
LC408409

USD 121.00

2 Weeks

CSNK1D HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Casein Kinase 1 delta (CSNK1D) Rabbit Polyclonal Antibody
TA349833

USD 345.00

4 Weeks

Rabbit Polyclonal Anti-CSNK1D Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1D
Casein Kinase 1 delta (CSNK1D) ICC Control Block
TB400482

USD 1,210.00

4 Weeks

Transient overexpression of CSNK1D (NM_001893) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Casein Kinase 1 delta (CSNK1D) ICC Control Block
TB404965

USD 1,070.00

4 Weeks

Transient overexpression of CSNK1D (NM_139062) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Casein Kinase 1 delta (CSNK1D) Cytosection
TS400482

USD 225.00

4 Weeks

Transient overexpression of CSNK1D (NM_001893) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Casein Kinase 1 delta (CSNK1D) Cytosection
TS400482P5

USD 889.00

4 Weeks

Transient overexpression of CSNK1D (NM_001893) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Casein Kinase 1 delta (CSNK1D) Cytosection
TS404965

USD 225.00

4 Weeks

Transient overexpression of CSNK1D (NM_139062) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Casein Kinase 1 delta (CSNK1D) Cytosection
TS404965P5

USD 889.00

4 Weeks

Transient overexpression of CSNK1D (NM_139062) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack