Products

cDNA Clones (11)
Antibodies (3)
Proteins (3)
Jump to Filters
View as table Download
GJD2 (NM_020660) Human Tagged ORF Clone Lentiviral Particle
RC210158L1V

USD 820.00

3 Weeks

Lenti ORF particles, GJD2 (Myc-DDK tagged) - Human gap junction protein, delta 2, 36kDa (GJD2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GJD2 (NM_020660) Human Tagged ORF Clone Lentiviral Particle
RC210158L2V

USD 820.00

6 Weeks

Lenti ORF particles, GJD2 (mGFP-tagged) - Human gap junction protein, delta 2, 36kDa (GJD2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GJD2 (NM_020660) Human Tagged ORF Clone
RC210158

USD 420.00

In Stock

GJD2 (Myc-DDK-tagged)-Human gap junction protein, delta 2, 36kDa (GJD2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
GJD2 (NM_020660) Human Tagged ORF Clone
RC210158L3

USD 620.00

3 Weeks

Lenti ORF clone of Human gap junction protein, delta 2, 36kDa (GJD2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GJD2 (NM_020660) Human Tagged ORF Clone Lentiviral Particle
RC210158L3V

USD 820.00

5 Weeks

Lenti ORF particles, GJD2 (Myc-DDK tagged) - Human gap junction protein, delta 2, 36kDa (GJD2), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GJD2 (NM_020660) Human Tagged ORF Clone
RC210158L4

USD 620.00

3 Weeks

Lenti ORF clone of Human gap junction protein, delta 2, 36kDa (GJD2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GJD2 (NM_020660) Human Tagged ORF Clone Lentiviral Particle
RC210158L4V

USD 820.00

7 Weeks

Lenti ORF particles, GJD2 (mGFP-tagged) - Human gap junction protein, delta 2, 36kDa (GJD2), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GJD2 (NM_020660) Human Tagged ORF Clone
RG210158

USD 460.00

3 Weeks

GJD2 (GFP-tagged) - Human gap junction protein, delta 2, 36kDa (GJD2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GJD2 (NM_020660) Human Untagged Clone
SC122104

USD 310.00

In Stock

GJD2 (untagged)-Human gap junction protein, delta 2, 36kDa (GJD2)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
GJD2 (NM_020660) Human Tagged ORF Clone
RC210158L1

USD 768.00

In Stock

Lenti ORF clone of Human gap junction protein, delta 2, 36kDa (GJD2), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GJD2 (NM_020660) Human Tagged ORF Clone
RC210158L2

USD 620.00

3 Weeks

Lenti ORF clone of Human gap junction protein, delta 2, 36kDa (GJD2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GJD2 Rabbit Polyclonal Antibody
TA341671

USD 375.00

5 Days

Rabbit Polyclonal Anti-GJD2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GJD2 antibody: synthetic peptide directed towards the middle region of human GJD2. Synthetic peptide located within the following region: ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPNFGRTQSSDSAY
GJD2 Rabbit Polyclonal Antibody
TA341701

USD 310.00

5 Days

Rabbit Polyclonal Anti-GJD2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CX36 antibody: synthetic peptide directed towards the middle region of human CX36. Synthetic peptide located within the following region: NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA
GJD2 Rabbit Polyclonal Antibody
TA322251

USD 345.00

In Stock

Anti-GJD2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 157-175 amino acids of Human gap junction protein, delta 2, 36kDa
GJD2 (NM_020660) ICC Control Block
TB410158

USD 1,070.00

4 Weeks

Transient overexpression of GJD2 (NM_020660) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GJD2 Cytosection
TS410158

USD 225.00

4 Weeks

Transient overexpression of GJD2 (NM_020660) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GJD2 Cytosection
TS410158P5

USD 889.00

4 Weeks

Transient overexpression of GJD2 (NM_020660) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack