GPD1L (Myc-DDK-tagged)-Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GPD1L (Myc-DDK-tagged)-Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GPD1L (Myc-DDK tagged) - Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GPD1L (mGFP-tagged) - Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human glycerol-3-phosphate dehydrogenase 1-like (GPD1L)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
GPD1L (GFP-tagged) - Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GPD1L (Myc-DDK tagged) - Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GPD1L (mGFP-tagged) - Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GPD1L (untagged)-Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
GPD1L (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 47-77 amino acids from the N-terminal region of human GPD1L |
Lenti ORF clone of Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Transient overexpression lysate of glycerol-3-phosphate dehydrogenase 1-like (GPD1L)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-GPD1L Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GPD1L Antibody: synthetic peptide directed towards the middle region of human GPD1L. Synthetic peptide located within the following region: ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV |
GPD1L (1-351, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
GPD1L (1-351, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
GPD1L HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GPD1L MS Standard C13 and N15-labeled recombinant protein (NP_055956)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of GPD1L (NM_015141) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPD1L (NM_015141) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GPD1L (NM_015141) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack