Germany
Japan
United Kingdom
China
GPD1L (Myc-DDK-tagged)-Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, GPD1L (Myc-DDK tagged) - Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GPD1L (mGFP-tagged) - Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Recombinant protein of human glycerol-3-phosphate dehydrogenase 1-like (GPD1L)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
GPD1L (GFP-tagged) - Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPD1L (Myc-DDK tagged) - Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GPD1L (mGFP-tagged) - Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GPD1L (untagged)-Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human glycerol-3-phosphate dehydrogenase 1-like (GPD1L), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of glycerol-3-phosphate dehydrogenase 1-like (GPD1L)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-GPD1L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GPD1L Antibody: synthetic peptide directed towards the middle region of human GPD1L. Synthetic peptide located within the following region: ELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPV |
GPD1L (1-351, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
GPD1L (1-351, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
GPD1L HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
GPD1L MS Standard C13 and N15-labeled recombinant protein (NP_055956)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of GPD1L (NM_015141) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GPD1L (NM_015141) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GPD1L (NM_015141) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GPD1L
Pathways
- Glycerophospholipid metabolism