Products

cDNA Clones (8)
Proteins (6)
Antibodies (2)
Jump to Filters
View as table Download
PGS1 (NM_024419) Human Tagged ORF Clone
RC211119

USD 480.00

In Stock

PGS1 (Myc-DDK-tagged)-Human phosphatidylglycerophosphate synthase 1 (PGS1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PGS1 (NM_024419) Human Tagged ORF Clone
RG211119

USD 530.00

In Stock

PGS1 (GFP-tagged) - Human phosphatidylglycerophosphate synthase 1 (PGS1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PGS1 (NM_024419) Human Tagged ORF Clone
RC211119L3

USD 680.00

3 Weeks

Lenti ORF clone of Human phosphatidylglycerophosphate synthase 1 (PGS1), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PGS1 (NM_024419) Human Tagged ORF Clone Lentiviral Particle
RC211119L3V

USD 880.00

6 Weeks

Lenti ORF particles, PGS1 (Myc-DDK tagged) - Human phosphatidylglycerophosphate synthase 1 (PGS1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PGS1 (NM_024419) Human Tagged ORF Clone
RC211119L4

USD 680.00

3 Weeks

Lenti ORF clone of Human phosphatidylglycerophosphate synthase 1 (PGS1), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PGS1 (NM_024419) Human Tagged ORF Clone Lentiviral Particle
RC211119L4V

USD 880.00

6 Weeks

Lenti ORF particles, PGS1 (mGFP-tagged) - Human phosphatidylglycerophosphate synthase 1 (PGS1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PGS1 Rabbit Polyclonal Antibody
TA346822

USD 475.00

5 Days

Rabbit Polyclonal Anti-PGS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGS1 antibody: synthetic peptide directed towards the C terminal of human PGS1. Synthetic peptide located within the following region: QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP
PGS1 (NM_024419) Human Untagged Clone
SC112229

USD 310.00

In Stock

PGS1 (untagged)-Human phosphatidylglycerophosphate synthase 1 (PGS1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
PGS1 Rabbit Polyclonal Antibody
TA346821

USD 410.00

5 Days

Rabbit Polyclonal Anti-PGS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGS1 antibody: synthetic peptide directed towards the C terminal of human PGS1. Synthetic peptide located within the following region: RVQLQEYWRRGWTFHAKGLWLYLAGSSLPCLTLIGSPNFGYRSVHRDLEA
PGS1 (NM_024419) Human Over-expression Lysate
LC402987

USD 121.00

2 Weeks

PGS1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PGS1 (NM_024419) Human Untagged Clone
SC317952

USD 760.00

3 Weeks

PGS1 (untagged)-Human phosphatidylglycerophosphate synthase 1 (PGS1)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
PGS1 (NM_024419) ICC Control Block
TB411119

USD 1,130.00

4 Weeks

Transient overexpression of PGS1 (NM_024419) in HEK293T cells paraffin embedded controls for ICC/IHC staining

PGS1 (NM_024419) Human Recombinant Protein
TP762446

USD 205.00

2 Weeks

Purified recombinant protein of Human phosphatidylglycerophosphate synthase 1 (PGS1), Ala29-End, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
PGS1 Cytosection
TS411119

USD 225.00

4 Weeks

Transient overexpression of PGS1 (NM_024419) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

PGS1 Cytosection
TS411119P5

USD 889.00

4 Weeks

Transient overexpression of PGS1 (NM_024419) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack