Products

Antibodies (12)

cDNA Clones (11)

Proteins (9)

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 32 of 32 results

(reset)

GATM (NM_001482) Human Tagged ORF Clone

RC200474

USD 98.00

USD 560.00

In Stock

GATM (Myc-DDK-tagged)-Human glycine amidinotransferase (L-arginine:glycine amidinotransferase) (GATM), nuclear gene encoding mitochondrial protein

Vector	pCMV6-Entry
Tag	Myc-DDK
Mammalian Cell Selection	Neomycin

• 

1 / 2

2 / 2

Previous Next

GATM (NM_001482) Human Recombinant Protein

TP300474

USD 823.00

In Stock

Recombinant protein of human glycine amidinotransferase (L-arginine:glycine amidinotransferase) (GATM), nuclear gene encoding mitochondrial protein

Tag	C-Myc/DDK
Expression Host	HEK293T

• 

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

GATM (NM_001482) Human Tagged ORF Clone Lentiviral Particle

RC200474L1V

USD 1,020.00

2 Weeks

Lenti ORF particles, GATM (Myc-DDK tagged) - Human glycine amidinotransferase (L-arginine:glycine amidinotransferase) (GATM), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK
Mammalian Cell Selection	None

• LentiORF^®
• 

GATM (NM_001482) Human Tagged ORF Clone Lentiviral Particle

RC200474L2V

USD 1,020.00

5 Weeks

Lenti ORF particles, GATM (mGFP-tagged) - Human glycine amidinotransferase (L-arginine:glycine amidinotransferase) (GATM), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP
Tag	mGFP
Mammalian Cell Selection	None

• LentiORF^®
• 

GATM (NM_001482) Human Tagged ORF Clone

RG200474

USD 460.00

In Stock

GATM (GFP-tagged) - Human glycine amidinotransferase (L-arginine:glycine amidinotransferase) (GATM), nuclear gene encoding mitochondrial protein

Vector	pCMV6-AC-GFP
Tag	TurboGFP
Mammalian Cell Selection	Neomycin

• TrueORF^®

GATM (NM_001482) Human Tagged Lenti ORF Clone

RC200474L3

USD 768.00

In Stock

Lenti ORF clone of Human glycine amidinotransferase (L-arginine:glycine amidinotransferase) (GATM), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®

GATM (NM_001482) Human Tagged ORF Clone Lentiviral Particle

RC200474L3V

USD 1,020.00

2 Weeks

Lenti ORF particles, GATM (Myc-DDK tagged) - Human glycine amidinotransferase (L-arginine:glycine amidinotransferase) (GATM), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector	pLenti-C-Myc-DDK-P2A-Puro
Tag	Myc-DDK
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

GATM (NM_001482) Human Tagged Lenti ORF Clone

RC200474L4

USD 768.00

In Stock

Lenti ORF clone of Human glycine amidinotransferase (L-arginine:glycine amidinotransferase) (GATM), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®

GATM (NM_001482) Human Tagged ORF Clone Lentiviral Particle

RC200474L4V

USD 1,020.00

2 Weeks

Lenti ORF particles, GATM (mGFP-tagged) - Human glycine amidinotransferase (L-arginine:glycine amidinotransferase) (GATM), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector	pLenti-C-mGFP-P2A-Puro
Tag	mGFP
Mammalian Cell Selection	Puromycin

• LentiORF^®
• 

GATM Rabbit Polyclonal Antibody

TA346701

USD 475.00

5 Days

Rabbit Polyclonal Anti-GATM Antibody

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-GATM antibody: synthetic peptide directed towards the middle region of human GATM. Synthetic peptide located within the following region: PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GATM (NM_001482) Human Tagged Lenti ORF Clone

RC200474L1

USD 768.00

In Stock

Lenti ORF clone of Human glycine amidinotransferase (L-arginine:glycine amidinotransferase) (GATM), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector	pLenti-C-Myc-DDK
Tag	Myc-DDK
Mammalian Cell Selection	None

• LentiORF^®

GATM (NM_001482) Human Untagged Clone

SC321307

USD 760.00

In Stock

GATM (untagged)-Human glycine amidinotransferase (L-arginine:glycine amidinotransferase) (GATM), nuclear gene encoding mitochondrial protein

Vector	pCMV6-AC
Tag	Tag Free
Mammalian Cell Selection	Neomycin

GATM (NM_001482) Human Tagged Lenti ORF Clone

RC200474L2

USD 768.00

3 Weeks

Lenti ORF clone of Human glycine amidinotransferase (L-arginine:glycine amidinotransferase) (GATM), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector	pLenti-C-mGFP
Tag	mGFP
Mammalian Cell Selection	None

• LentiORF^®

GATM (N-term) Rabbit Polyclonal Antibody

AP51788PU-N

USD 450.00

2 Weeks

GATM (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide selected between amino acids 70 and 100 of Human Glycine amidinotransferase

1 / 2

2 / 2

Previous Next

GATM (NM_001482) Human Over-expression Lysate

LC419923

USD 121.00

In Stock

GATM HEK293T cell transient overexpression lysate (as WB positive control)

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

GATM (NM_001482) Human Over-expression Lysate

LY419923

USD 396.00

5 Days

Transient overexpression lysate of glycine amidinotransferase (L-arginine:glycine amidinotransferase) (GATM), nuclear gene encoding mitochondrial protein

Tag	C-Myc/DDK
Expression Host	HEK293T
Applications	WB

Glycine amidinotransferase (38-423, His-tag) Human Protein

AR50263PU-N

USD 1,105.00

2 Weeks

Glycine amidinotransferase (38-423, His-tag) human recombinant protein, 0.25 mg

Tag	His-tag
Expression Host	E. coli

Glycine amidinotransferase (38-423, His-tag) Human Protein

AR50263PU-S

USD 415.00

2 Weeks

Glycine amidinotransferase (38-423, His-tag) human recombinant protein, 50 µg

Tag	His-tag
Expression Host	E. coli

GATM Mouse Monoclonal Antibody [Clone ID: OTI1C9]

CF503147

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

GATM Mouse Monoclonal Antibody [Clone ID: OTI1E3]

CF503207

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

GATM (NM_001482) Human Mass Spec Standard

PH300474

USD 2,055.00

3 Weeks

GATM MS Standard C13 and N15-labeled recombinant protein (NP_001473)

Tag	C-Myc/DDK
Expression Host	HEK293

GATM Mouse Monoclonal Antibody [Clone ID: OTI1C9]

TA503147

USD 379.00

In Stock

GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

GATM Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C9]

TA503147AM

USD 420.00

4 Weeks

GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

GATM Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C9]

TA503147BM

USD 420.00

4 Weeks

GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

GATM Mouse Monoclonal Antibody [Clone ID: OTI1C9]

TA503147S

USD 159.00

In Stock

GATM mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

GATM Mouse Monoclonal Antibody [Clone ID: OTI1E3]

TA503207

USD 379.00

In Stock

GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

GATM Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E3]

TA503207AM

USD 420.00

4 Weeks

GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

GATM Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1E3]

TA503207BM

USD 420.00

4 Weeks

GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

GATM Mouse Monoclonal Antibody [Clone ID: OTI1E3]

TA503207S

USD 159.00

2 Days

GATM mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

GATM ICC Control Block

TB400474

USD 1,210.00

4 Weeks

Transient overexpression of GATM (NM_001482) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GATM Cytosection

TS400474

USD 225.00

4 Weeks

Transient overexpression of GATM (NM_001482) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GATM Cytosection

TS400474P5

USD 889.00

4 Weeks

Transient overexpression of GATM (NM_001482) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

1 - 32 of 32 results