Products

cDNA Clones (10)
Proteins (7)
Antibodies (3)
Jump to Filters
View as table Download
Pyruvate Dehydrogenase E2 (DLAT) (NM_001931) Human Tagged ORF Clone
RG206640

USD 460.00

In Stock

DLAT (GFP-tagged) - Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pyruvate Dehydrogenase E2 (DLAT) (NM_001931) Human Tagged ORF Clone Lentiviral Particle
RC206640L1V

USD 820.00

3 Weeks

Lenti ORF particles, DLAT (Myc-DDK tagged) - Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Pyruvate Dehydrogenase E2 (DLAT) (NM_001931) Human Tagged ORF Clone Lentiviral Particle
RC206640L2V

USD 820.00

6 Weeks

Lenti ORF particles, DLAT (mGFP-tagged) - Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Pyruvate Dehydrogenase E2 (DLAT) (NM_001931) Human Tagged ORF Clone
RC206640L3

USD 620.00

3 Weeks

Lenti ORF clone of Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pyruvate Dehydrogenase E2 (DLAT) (NM_001931) Human Tagged ORF Clone Lentiviral Particle
RC206640L3V

USD 820.00

5 Weeks

Lenti ORF particles, DLAT (Myc-DDK tagged) - Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pyruvate Dehydrogenase E2 (DLAT) (NM_001931) Human Tagged ORF Clone Lentiviral Particle
RC206640L4V

USD 820.00

7 Weeks

Lenti ORF particles, DLAT (mGFP-tagged) - Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pyruvate Dehydrogenase E2 (DLAT) Rabbit Polyclonal Antibody
TA346311

USD 410.00

5 Days

Rabbit Polyclonal Anti-DLAT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLAT antibody: synthetic peptide directed towards the N terminal of human DLAT. Synthetic peptide located within the following region: WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR
Pyruvate Dehydrogenase E2 (DLAT) Rabbit Polyclonal Antibody
TA346312

USD 475.00

5 Days

Rabbit Polyclonal Anti-DLAT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLAT antibody: synthetic peptide directed towards the C terminal of human DLAT. Synthetic peptide located within the following region: DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA
Pyruvate Dehydrogenase E2 (DLAT) (NM_001931) Human Tagged ORF Clone
RC206640L2

USD 620.00

3 Weeks

Lenti ORF clone of Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Pyruvate Dehydrogenase E2 (DLAT) (NM_001931) Human Untagged Clone
SC100111

USD 760.00

In Stock

DLAT (untagged)-Human dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Pyruvate Dehydrogenase E2 (DLAT) (NM_001931) Human Over-expression Lysate
LY419633

USD 396.00

5 Days

Transient overexpression lysate of dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Pyruvate Dehydrogenase E2 (DLAT) (NM_001931) Human Over-expression Lysate
LC419633

USD 121.00

2 Weeks

DLAT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Pyruvate Dehydrogenase E2 (DLAT) Rabbit Polyclonal Antibody
TA350579

USD 345.00

In Stock

Rabbit Polyclonal Anti-DLAT Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human DLAT
Pyruvate Dehydrogenase E2 (DLAT) ICC Control Block
TB406640

USD 1,070.00

4 Weeks

Transient overexpression of DLAT (NM_001931) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Pyruvate Dehydrogenase E2 (DLAT) Cytosection
TS406640

USD 225.00

4 Weeks

Transient overexpression of DLAT (NM_001931) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Pyruvate Dehydrogenase E2 (DLAT) Cytosection
TS406640P5

USD 889.00

4 Weeks

Transient overexpression of DLAT (NM_001931) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack