Pyruvate Dehydrogenase E2 (DLAT) Rabbit Polyclonal Antibody

CAT#: TA346312

Rabbit Polyclonal Anti-DLAT Antibody


USD 475.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Recombinant protein of human dihydrolipoamide S-acetyltransferase (DLAT)
    • 20 ug

USD 823.00


Transient overexpression lysate of dihydrolipoamide S-acetyltransferase (DLAT), nuclear gene encoding mitochondrial protein
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Other products for "DLAT"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DLAT antibody: synthetic peptide directed towards the C terminal of human DLAT. Synthetic peptide located within the following region: DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 69 kDa
Gene Name dihydrolipoamide S-acetyltransferase
Background DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.The DLAT gene encodes dihydrolipoamide acetyltransferase (EC 2.3.1.12), the E2 subunit of the mammalian pyruvate dehydrogenase complex (PDC; EC 1.2.4.1) of the inner mitochondrial membrane. Patients with primary biliary cirrhosis (PBC; MIM 109720) show autoantibodies to DLAT. [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2696 AK057299.1 1-2696 2697-3933 BC039084.1 2066-3302 3934-4322 DB551427.1 98-486
Synonyms DLTA; PDC-E2; PDCE2
Note Immunogen Sequence Homology: Caenorhabditis briggsae:100%; Human:100%; Mouse:100%; Green puffer:100%; Caenorhabditis elegans:100%; Golden hamster:100%; Rat:100%; Caenorhabditis vulgaris:100%; Dog:100%; Chicken:100%; Pig:92%; Sphingomonas aromaticivorans:9
Reference Data
Protein Families Druggable Genome
Protein Pathways Citrate cycle (TCA cycle), Glycolysis / Gluconeogenesis, Metabolic pathways, Pyruvate metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.