PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human phosphofructokinase, muscle (PFKM)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, PFKM (Myc-DDK tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PFKM (mGFP-tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PFKM (GFP-tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PFKM (GFP-tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human phosphofructokinase, muscle (PFKM), transcript variant 4, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PFKM (Myc-DDK tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human phosphofructokinase, muscle (PFKM), transcript variant 4, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PFKM (mGFP-tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PFKM (mGFP-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PFKM (mGFP-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PFKM (mGFP-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PFKM (mGFP-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PFKM (Myc-DDK-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PFKM (mGFP-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PFKM (mGFP-tagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PFKM (GFP-tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PFKM (GFP-tagged) - Human phosphofructokinase, muscle (PFKM), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal antibody to PFK (muscle) (phosphofructokinase, muscle)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 253 of PFK (muscle) (Uniprot ID#P08237) |
Lenti ORF clone of Human phosphofructokinase, muscle (PFKM), transcript variant 4, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PFKM (untagged)-Human phosphofructokinase, muscle (PFKM), transcript variant 4
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit anti-PFKM Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PFKM |
PFKM mouse monoclonal antibody, clone AT2F11, Purified
Applications | ELISA, FC, WB |
Reactivities | Human |
PFKM mouse monoclonal antibody, clone AT2F11, Purified
Applications | ELISA, FC, WB |
Reactivities | Human |
Lenti ORF clone of Human phosphofructokinase, muscle (PFKM), transcript variant 4, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PFKM HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PFKM (untagged)-Human phosphofructokinase muscle (PFKM) transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-PFKM Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PFKM antibody: synthetic peptide directed towards the C terminal of human PFKM. Synthetic peptide located within the following region: RALVFQPVAELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHA |
PFKM (1-780, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
PFKM (1-780, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Transient overexpression lysate of phosphofructokinase, muscle (PFKM), transcript variant 4
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PFKM MS Standard C13 and N15-labeled recombinant protein (NP_000280)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
PFKM (untagged)-Human phosphofructokinase muscle (PFKM) transcript variant 3
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PFKM (untagged)-Human phosphofructokinase muscle (PFKM) transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression of PFKM (NM_000289) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PFKM (NM_001166687) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PFKM (NM_001166688) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PFKM (NM_001166686) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PFKM (NM_000289) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PFKM (NM_000289) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PFKM (NM_001166687) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack