Products

cDNA Clones (18)
Proteins (6)
Antibodies (3)
Jump to Filters
View as table Download
ADCY6 (NM_020983) Human Tagged ORF Clone
RC214902

USD 1,170.00

In Stock

ADCY6 (Myc-DDK-tagged)-Human adenylate cyclase 6 (ADCY6), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ADCY6 (NM_015270) Human Tagged ORF Clone
RC209021

USD 1,010.00

In Stock

ADCY6 (Myc-DDK-tagged)-Human adenylate cyclase 6 (ADCY6), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
ADCY6 (NM_020983) Human Tagged ORF Clone Lentiviral Particle
RC214902L1V

USD 1,570.00

3 Weeks

Lenti ORF particles, ADCY6 (Myc-DDK tagged) - Human adenylate cyclase 6 (ADCY6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
ADCY6 (NM_020983) Human Tagged ORF Clone Lentiviral Particle
RC214902L2V

USD 1,570.00

6 Weeks

Lenti ORF particles, ADCY6 (mGFP-tagged) - Human adenylate cyclase 6 (ADCY6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
ADCY6 (NM_015270) Human Tagged ORF Clone
RC209021L3

USD 1,210.00

3 Weeks

Lenti-ORF clone of ADCY6 (Myc-DDK-tagged)-Human adenylate cyclase 6 (ADCY6), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ADCY6 (NM_015270) Human Tagged ORF Clone Lentiviral Particle
RC209021L3V

USD 1,410.00

6 Weeks

Lenti ORF particles, ADCY6 (Myc-DDK-tagged)-Human adenylate cyclase 6 (ADCY6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ADCY6 (NM_015270) Human Tagged ORF Clone
RC209021L4

USD 1,210.00

3 Weeks

Lenti-ORF clone of ADCY6 (mGFP-tagged)-Human adenylate cyclase 6 (ADCY6), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ADCY6 (NM_015270) Human Tagged ORF Clone Lentiviral Particle
RC209021L4V

USD 1,410.00

6 Weeks

Lenti ORF particles, ADCY6 (mGFP-tagged)-Human adenylate cyclase 6 (ADCY6), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ADCY6 (NM_020983) Human Tagged ORF Clone
RC214902L3

USD 1,370.00

3 Weeks

Lenti ORF clone of Human adenylate cyclase 6 (ADCY6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ADCY6 (NM_020983) Human Tagged ORF Clone Lentiviral Particle
RC214902L3V

USD 1,570.00

7 Weeks

Lenti ORF particles, ADCY6 (Myc-DDK tagged) - Human adenylate cyclase 6 (ADCY6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
ADCY6 (NM_020983) Human Tagged ORF Clone
RC214902L4

USD 1,370.00

3 Weeks

Lenti ORF clone of Human adenylate cyclase 6 (ADCY6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ADCY6 (NM_020983) Human Tagged ORF Clone Lentiviral Particle
RC214902L4V

USD 1,570.00

7 Weeks

Lenti ORF particles, ADCY6 (mGFP-tagged) - Human adenylate cyclase 6 (ADCY6), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
ADCY6 (NM_015270) Human Tagged ORF Clone
RG209021

USD 1,110.00

2 Weeks

ADCY6 (GFP-tagged) - Human adenylate cyclase 6 (ADCY6), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ADCY6 (NM_020983) Human Tagged ORF Clone
RG214902

USD 1,290.00

In Stock

ADCY6 (GFP-tagged) - Human adenylate cyclase 6 (ADCY6), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
ADCY6 (NM_015270) Human Untagged Clone
SC126190

USD 2,360.00

In Stock

ADCY6 (untagged)-Human adenylate cyclase 6 (ADCY6), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
ADCY6 (NM_020983) Human Tagged Lenti ORF Clone
RC214902L1

USD 1,692.00

In Stock

Lenti ORF clone of Human adenylate cyclase 6 (ADCY6), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
ADCY6 Rabbit Polyclonal Antibody
TA341966

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-ADCY6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY
ADCY6 Rabbit Polyclonal Antibody
TA313425

USD 345.00

In Stock

Rabbit polyclonal anti-ADCY5/6 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY5/6.
ADCY6 (NM_020983) Human Tagged ORF Clone
RC214902L2

USD 1,370.00

3 Weeks

Lenti ORF clone of Human adenylate cyclase 6 (ADCY6), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
ADCY6 Rabbit Polyclonal Antibody
TA310097

USD 230.00

3 Weeks

Rabbit anti-ADCY6 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH
ADCY6 (NM_020983) Human Untagged Clone
SC315194

USD 2,270.00

3 Weeks

ADCY6 (untagged)-Human adenylate cyclase 6 (ADCY6), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
ADCY6 ICC Control Block
TB409021

USD 1,660.00

4 Weeks

Transient overexpression of ADCY6 (NM_015270) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ADCY6 ICC Control Block
TB414902

USD 1,820.00

4 Weeks

Transient overexpression of ADCY6 (NM_020983) in HEK293T cells paraffin embedded controls for ICC/IHC staining

ADCY6 Cytosection
TS409021

USD 225.00

4 Weeks

Transient overexpression of ADCY6 (NM_015270) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ADCY6 Cytosection
TS409021P5

USD 889.00

4 Weeks

Transient overexpression of ADCY6 (NM_015270) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

ADCY6 Cytosection
TS414902

USD 225.00

4 Weeks

Transient overexpression of ADCY6 (NM_020983) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

ADCY6 ICC Control Sections
TS414902P5

USD 889.00

4 Weeks

Transient overexpression of ADCY6 (NM_020983) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack