Products

cDNA Clones (7)
Proteins (5)
Antibodies (1)
Jump to Filters
View as table Download
CALML6 (NM_138705) Human Tagged ORF Clone
RC222115

USD 420.00

In Stock

CALML6 (Myc-DDK-tagged)-Human calmodulin-like 6 (CALML6)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CALML6 (NM_138705) Human Tagged ORF Clone
RC222115L3

USD 620.00

3 Weeks

Lenti ORF clone of Human calmodulin-like 6 (CALML6), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CALML6 (NM_138705) Human Tagged ORF Clone
RC222115L4

USD 620.00

3 Weeks

Lenti ORF clone of Human calmodulin-like 6 (CALML6), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CALML6 (NM_138705) Human Tagged ORF Clone
RG222115

USD 460.00

3 Weeks

CALML6 (GFP-tagged) - Human calmodulin-like 6 (CALML6)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CALML6 (NM_138705) Human Over-expression Lysate
LY408555

USD 396.00

5 Days

Transient overexpression lysate of calmodulin-like 6 (CALML6)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CALML6 Rabbit Polyclonal Antibody
TA331664

USD 375.00

5 Days

Rabbit Polyclonal Anti-CALML6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CALML6 Antibody is: synthetic peptide directed towards the C-terminal region of Human CALML6. Synthetic peptide located within the following region: YHEKAQNQESELRAAFRVFDKEGKGYIDWNTLKYVLMNAGEPLNEVEAEQ
CALML6 (NM_138705) Human Over-expression Lysate
LC408555

USD 121.00

2 Weeks

CALML6 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CALML6 (NM_138705) Human Untagged Clone
SC306064

USD 420.00

3 Weeks

CALML6 (untagged)-Human calmodulin-like 6 (CALML6)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CALML6 (NM_138705) ICC Control Block
TB422115

USD 1,070.00

4 Weeks

Transient overexpression of CALML6 (NM_138705) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CALML6 Cytosection
TS422115

USD 225.00

4 Weeks

Transient overexpression of CALML6 (NM_138705) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CALML6 Cytosection
TS422115P5

USD 889.00

4 Weeks

Transient overexpression of CALML6 (NM_138705) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack