Products

cDNA Clones (29)
Proteins (20)
Antibodies (5)
Jump to Filters
View as table Download
CDC42 (NM_001791) Human Tagged ORF Clone
RC214076

USD 98.00

USD 390.00

In Stock

CDC42 (Myc-DDK-tagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CDC42 (NM_044472) Human Tagged ORF Clone
RC216559

USD 98.00

USD 390.00

In Stock

CDC42 (Myc-DDK-tagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CDC42 (NM_001039802) Human Tagged ORF Clone
RC219153

USD 420.00

In Stock

CDC42 (Myc-DDK-tagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
CDC42 (NM_001791) Human Tagged ORF Clone
RG214076

USD 460.00

In Stock

CDC42 (GFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC42 (NM_001791) Human Tagged ORF Clone Lentiviral Particle
RC214076L1V

USD 820.00

3 Weeks

Lenti ORF particles, CDC42 (Myc-DDK tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CDC42 (NM_001791) Human Tagged ORF Clone Lentiviral Particle
RC214076L2V

USD 820.00

6 Weeks

Lenti ORF particles, CDC42 (mGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CDC42 (NM_044472) Human Tagged ORF Clone Lentiviral Particle
RC216559L1V

USD 820.00

3 Weeks

Lenti ORF particles, CDC42 (Myc-DDK tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
CDC42 (NM_044472) Human Tagged ORF Clone Lentiviral Particle
RC216559L2V

USD 820.00

6 Weeks

Lenti ORF particles, CDC42 (mGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
CDC42 (NM_044472) Human Tagged ORF Clone
RG216559

USD 460.00

In Stock

CDC42 (GFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC42 (NM_001039802) Human Tagged ORF Clone
RG219153

USD 460.00

In Stock

CDC42 (GFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CDC42 (NM_001791) Human Tagged ORF Clone Lentiviral Particle
RC214076L3V

USD 820.00

5 Weeks

Lenti ORF particles, CDC42 (Myc-DDK tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC42 (NM_001791) Human Tagged ORF Clone Lentiviral Particle
RC214076L4V

USD 820.00

3 Weeks

Lenti ORF particles, CDC42 (mGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC42 (NM_044472) Human Tagged ORF Clone
RC216559L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC42 (NM_044472) Human Tagged ORF Clone Lentiviral Particle
RC216559L3V

USD 820.00

5 Weeks

Lenti ORF particles, CDC42 (Myc-DDK tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC42 (NM_044472) Human Tagged ORF Clone
RC216559L4

USD 620.00

3 Weeks

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC42 (NM_044472) Human Tagged ORF Clone Lentiviral Particle
RC216559L4V

USD 820.00

7 Weeks

Lenti ORF particles, CDC42 (mGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC42 (NM_001039802) Human Tagged ORF Clone
RC219153L3

USD 620.00

3 Weeks

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC42 (NM_001039802) Human Tagged ORF Clone Lentiviral Particle
RC219153L3V

USD 820.00

6 Weeks

Lenti ORF particles, CDC42 (Myc-DDK tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC42 (NM_001039802) Human Tagged ORF Clone
RC219153L4

USD 620.00

3 Weeks

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC42 (NM_001039802) Human Tagged ORF Clone Lentiviral Particle
RC219153L4V

USD 820.00

6 Weeks

Lenti ORF particles, CDC42 (mGFP-tagged) - Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC42 (NM_001791) Human Tagged Lenti ORF Clone
RC214076L3

USD 768.00

3 Weeks

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC42 (NM_001791) Human Tagged ORF Clone
RC214076L1

USD 768.00

In Stock

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CDC42 (NM_001791) Human Tagged ORF Clone
RC214076L4

USD 768.00

In Stock

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CDC42 (NM_044472) Human Tagged ORF Clone
RC216559L1

USD 768.00

In Stock

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
CDC42 (NM_001791) Human Untagged Clone
SC109055

USD 310.00

In Stock

CDC42 (untagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CDC42 (NM_001039802) Human Over-expression Lysate
LY421832

USD 396.00

In Stock

Transient overexpression lysate of cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDC42 Rabbit Polyclonal Antibody
TA326982

USD 275.00

3 Weeks

Rabbit anti-CDC42 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDC42
CDC42 (NM_001791) Human Tagged ORF Clone
RC214076L2

USD 620.00

3 Weeks

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CDC42 (NM_044472) Human Tagged ORF Clone
RC216559L2

USD 620.00

3 Weeks

Lenti ORF clone of Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CDC42 (NM_001791) Human Over-expression Lysate
LC400679

USD 121.00

In Stock

CDC42 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
CDC42 (NM_044472) Human Over-expression Lysate
LC409470

USD 121.00

In Stock

CDC42 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDC42 (NM_001039802) Human Over-expression Lysate
LC421832

USD 121.00

In Stock

CDC42 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDC42 (NM_001791) Human Over-expression Lysate
LY400679

USD 396.00

5 Days

Transient overexpression lysate of cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDC42 (NM_044472) Human Over-expression Lysate
LY409470

USD 396.00

In Stock

Transient overexpression lysate of cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CDC42 (NM_044472) Human Untagged Clone
SC109056

USD 420.00

In Stock

CDC42 (untagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CDC42 Chicken Polyclonal Antibody
TA306749

USD 430.00

5 Days

Chicken Polyclonal CDC42 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CDC42 antibody was raised against a 17 amino acid peptide near the amino terminus of human CDC42.
CDC42 Rabbit Polyclonal Antibody
TA318866

USD 380.00

3 Weeks

Rabbit polyclonal anti-cdc42/Rac antibody

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptides surrounding amino acid 144 of human cdc42
CDC42 Rabbit Polyclonal Antibody
TA330323

USD 375.00

5 Days

Rabbit Polyclonal Anti-CDC42 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC42 antibody: synthetic peptide directed towards the N terminal of human CDC42. Synthetic peptide located within the following region: DNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSP
CDC42 (1-188, T7-tag) Human Protein
AR09278PU-L

USD 620.00

2 Weeks

CDC42 (1-188, T7-tag) human recombinant protein, 0.5 mg

Tag T7-tag
Expression Host E. coli
CDC42 (1-188, T7-tag) Human Protein
AR09278PU-N

USD 260.00

2 Weeks

CDC42 (1-188, T7-tag) human recombinant protein, 0.1 mg

Tag T7-tag
Expression Host E. coli
CDC42 (NM_001791) Human Mass Spec Standard
PH314076

USD 2,055.00

3 Weeks

CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_001782)

Tag C-Myc/DDK
Expression Host HEK293
CDC42 (NM_044472) Human Mass Spec Standard
PH316559

USD 2,055.00

3 Weeks

CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_426359)

Tag C-Myc/DDK
Expression Host HEK293
CDC42 (NM_001039802) Human Mass Spec Standard
PH319153

USD 2,055.00

3 Weeks

CDC42 MS Standard C13 and N15-labeled recombinant protein (NP_001034891)

Tag C-Myc/DDK
Expression Host HEK293
CDC42 (NM_001039802) Human Untagged Clone
SC311054

USD 420.00

3 Weeks

CDC42 (untagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
CDC42 Rabbit Polyclonal Antibody
TA321400

USD 345.00

In Stock

Anti-Cdc42/Rho/Rac Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 57-71 amino acids of Human Cell division cycle 42
CDC42 ICC Control Block
TB414076

USD 1,040.00

4 Weeks

Transient overexpression of CDC42 (NM_001791) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CDC42 ICC Control Block
TB416559

USD 1,040.00

4 Weeks

Transient overexpression of CDC42 (NM_044472) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CDC42 ICC Control Block
TB419153

USD 1,070.00

4 Weeks

Transient overexpression of CDC42 (NM_001039802) in HEK293T cells paraffin embedded controls for ICC/IHC staining

CDC42 Cytosection
TS414076

USD 225.00

4 Weeks

Transient overexpression of CDC42 (NM_001791) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

CDC42 Cytosection
TS414076P5

USD 889.00

4 Weeks

Transient overexpression of CDC42 (NM_001791) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack