Products

Proteins (8)
cDNA Clones (6)
Antibodies (2)
Jump to Filters
View as table Download
JMJD7-PLA2G4B (NM_005090) Human Tagged ORF Clone
RC223316

USD 1,060.00

In Stock

JMJD7 (Myc-DDK-tagged)-Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
JMJD7-PLA2G4B (NM_005090) Human Tagged ORF Clone
RC223316L3

USD 1,260.00

3 Weeks

Lenti ORF clone of Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JMJD7-PLA2G4B (NM_005090) Human Tagged ORF Clone
RC223316L4

USD 1,260.00

3 Weeks

Lenti ORF clone of Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JMJD7-PLA2G4B (NM_001198588) Human Tagged ORF Clone
RC231436L3

USD 1,190.00

5 Weeks

Lenti-ORF clone of JMJD7 (Myc-DDK-tagged)-Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
JMJD7-PLA2G4B (NM_001198588) Human Tagged ORF Clone
RC231436L4

USD 1,190.00

5 Weeks

Lenti-ORF clone of JMJD7 (mGFP-tagged)-Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
JMJD7 (NM_005090) Human Untagged Clone
SC303580

USD 2,040.00

In Stock

JMJD7 (untagged)-Human JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
JMJD7-PLA2G4B Rabbit Polyclonal Antibody
TA339106

USD 375.00

5 Days

Rabbit Polyclonal Anti-PLA2G4B Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-PLA2G4B antibody: synthetic peptide directed towards the N terminal of human PLA2G4B. Synthetic peptide located within the following region: KDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVD
JMJD7-PLA2G4B Rabbit Polyclonal Antibody
TA343501

USD 375.00

5 Days

Rabbit Polyclonal Anti-PLA2G4B Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-PLA2G4B antibody: synthetic peptide directed towards the N terminal of human PLA2G4B. Synthetic peptide located within the following region: AEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRP
JMJD7-PLA2G4B (NM_005090) Human Over-expression Lysate
LC417529

USD 187.00

2 Weeks

JMJD7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
JMJD7-PLA2G4B (NM_005090) Human Over-expression Lysate
LY417529

USD 605.00

5 Days

Transient overexpression lysate of JMJD7-PLA2G4B readthrough (JMJD7-PLA2G4B), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
JMJD7-PLA2G4B (NM_005090) Human Mass Spec Standard
PH323316

USD 2,055.00

3 Weeks

JMJD7 MS Standard C13 and N15-labeled recombinant protein (NP_005081)

Tag C-Myc/DDK
Expression Host HEK293
JMJD7-PLA2G4B (NM_005090) ICC Control Block
TB423316

USD 1,710.00

4 Weeks

Transient overexpression of JMJD7-PLA2G4B (NM_005090) in HEK293T cells paraffin embedded controls for ICC/IHC staining

JMJD7-PLA2G4B (NM_001198588) ICC Control Block
TB431436

USD 1,640.00

4 Weeks

Transient overexpression of JMJD7-PLA2G4B (NM_001198588) in HEK293T cells paraffin embedded controls for ICC/IHC staining

JMJD7-PLA2G4B Cytosection
TS423316

USD 225.00

4 Weeks

Transient overexpression of JMJD7-PLA2G4B (NM_005090) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

JMJD7-PLA2G4B Cytosection
TS423316P5

USD 889.00

4 Weeks

Transient overexpression of JMJD7-PLA2G4B (NM_005090) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

JMJD7-PLA2G4B ICC Control Sections
TS431436P5

USD 889.00

4 Weeks

Transient overexpression of JMJD7-PLA2G4B (NM_001198588) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack