Products

cDNA Clones (11)
Antibodies (4)
Proteins (4)
Jump to Filters
View as table Download
MEKK1 (MAP3K1) (NM_005921) Human Tagged ORF Clone
RC214358

USD 1,590.00

In Stock

MAP3K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)

Vector pCMV6-AC-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
MEKK1 (MAP3K1) (NM_005921) Human Tagged ORF Clone
RC214358L3

USD 1,790.00

3 Weeks

Lenti-ORF clone of MAP3K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MEKK1 (MAP3K1) (NM_005921) Human Tagged ORF Clone Lentiviral Particle
RC214358L3V

USD 1,990.00

7 Weeks

Lenti ORF particles, MAP3K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
MEKK1 (MAP3K1) (NM_005921) Human Tagged ORF Clone
RC214358L4

USD 1,790.00

3 Weeks

Lenti-ORF clone of MAP3K1 (mGFP-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
MEKK1 (MAP3K1) (NM_005921) Human Tagged ORF Clone
RG214358

USD 1,750.00

3 Weeks

MAP3K1 (GFP-tagged) - Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
MEKK1 (MAP3K1) (NM_005921) Human Untagged Clone
SC316878

USD 3,060.00

In Stock

MAP3K1 (untagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
MEKK1 (MAP3K1) Rabbit Polyclonal Antibody
TA314186

USD 345.00

In Stock

Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A).
Modifications Phospho-specific
MEKK1 (MAP3K1) Rabbit Polyclonal Antibody
TA346746

USD 475.00

5 Days

Rabbit Polyclonal Anti-MAP3K1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K1 antibody: synthetic peptide directed towards the C terminal of human MAP3K1. Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH
MEKK1 (MAP3K1) (NM_005921) Human Tagged ORF Clone
RC214358L1

USD 1,790.00

3 Weeks

Lenti-ORF clone of MAP3K1 (Myc-DDK-tagged)-Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
MEKK1 (MAP3K1) (NM_005921) Human Untagged Clone
SC323618

USD 3,060.00

In Stock

MAP3K1 (untagged)-Kinase deficient mutant (K1108M) of Human mitogen-activated protein kinase kinase kinase 1 (MAP3K1)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
MEKK1 (MAP3K1) Rabbit Polyclonal Antibody
TA314185

USD 345.00

In Stock

Rabbit polyclonal anti-MAP3K1 antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MAP3K1.
MEKK1 (MAP3K1) Rabbit Polyclonal Antibody
TA354403

USD 355.00

5 Days

Rabbit anti Mekk-1 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
MEKK1 (MAP3K1) (NM_005921) Human Mass Spec Standard
PH314358

USD 2,055.00

3 Weeks

MAP3K1 MS Standard C13 and N15-labeled recombinant protein (NP_005912)

Tag C-Myc/DDK
Expression Host HEK293
MEKK1 (MAP3K1) ICC Control Block
TB414358

USD 2,240.00

4 Weeks

Transient overexpression of MAP3K1 (NM_005921) in HEK293T cells paraffin embedded controls for ICC/IHC staining

MEKK1 (MAP3K1) Cytosection
TS414358

USD 225.00

4 Weeks

Transient overexpression of MAP3K1 (NM_005921) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

MEKK1 (MAP3K1) Cytosection
TS414358P5

USD 889.00

4 Weeks

Transient overexpression of MAP3K1 (NM_005921) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack